KEGG   Shewanella sp. W3-18-1: Sputw3181_0086Help
Entry
Sputw3181_0086    CDS       T00453                                 

Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
shw  Shewanella sp. W3-18-1
Pathway
shw00620  Pyruvate metabolism
shw00630  Glyoxylate and dicarboxylate metabolism
shw01100  Metabolic pathways
shw01110  Biosynthesis of secondary metabolites
shw01120  Microbial metabolism in diverse environments
shw01200  Carbon metabolism
Module
shw_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:shw00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sputw3181_0086
   00630 Glyoxylate and dicarboxylate metabolism
    Sputw3181_0086
Enzymes [BR:shw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Sputw3181_0086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2431
Motif
Other DBs
NCBI-ProteinID: ABM22939
JGI: Sputw31810086
Position
complement(104777..105340)
Genome map
AA seq 187 aa AA seqDB search
MNMSIIKSNQIQSNLNSLIAEEVFAVAQVNVAEHEKIANAKQFLDRVFPLNSGSHQDVSS
YVVYYQHLLAFFADGSHSGLRQPKQFVAFGGTKDSPSAVVLQDQGCHVELSFDRNGMIGT
RDVANLEDIQIETPLNMVAGTPESRSAASRHWLSLLHAGMSSANDTLEKQFTAKDGSDYS
LKSIVNL
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgtcaattatcaagagcaaccagatccaatcgaatctaaacagtctcatcgca
gaagaagtatttgccgtggcccaagtgaatgttgcagaacacgagaagatcgccaacgca
aaacagtttcttgaccgagtgtttccgctcaactctggctcacatcaagatgtcagtagc
tatgtcgtctactaccaacatctcttagcattttttgccgatggcagtcacagtggttta
cgtcagccaaaacaatttgtcgcctttggtggaacgaaagactcacccagcgccgtagtg
ttacaggatcaaggttgccatgttgagctcagtttcgatcgcaatggcatgataggcacc
agagatgtggctaatctggaggatatccaaatcgagacaccattaaatatggtggcagga
acaccagagtcacgctcagccgcatcacgccattggctaagtctgttgcacgcaggaatg
tccagcgccaacgacacgctagagaagcaattcacagccaaagatggcagcgattacagt
ttgaaaagtatagtaaatttataa

DBGET integrated database retrieval system