KEGG   Shewanella sp. W3-18-1: Sputw3181_0334Help
Entry
Sputw3181_0334    CDS       T00453                                 

Definition
(GenBank) GTP cyclohydrolase
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
shw  Shewanella sp. W3-18-1
Pathway
shw00790  Folate biosynthesis
shw01100  Metabolic pathways
Module
shw_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:shw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sputw3181_0334
Enzymes [BR:shw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Sputw3181_0334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: ABM23185
JGI: Sputw31810334
UniProt: A1REU0
Position
complement(361310..361954)
Genome map
AA seq 214 aa AA seqDB search
MALSEAAVKVQAALLERGLETPMLPSVYSSEERKDKIEHHMKEILTLMSLDLSDDSLADT
PRRIAKMYVDEIFSGLDYENFPKITVIDNKMGFDEMVRVQDISLTSTCEHHLVTIDGTAT
IAYLPRKKIIGLSKINRIVRFFAQRPQVQERLTQQVLVALQTLLETKDVAVKMDAVHYCV
KSRGVMDSTSSTTTTALGGIFKSNPATRAEFLHQ
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atggcattaagtgaagcagcagtaaaagtacaagccgcgttattagaacgtggacttgaa
acccccatgctccccagcgtttacagcagtgaagaacgtaaagacaagattgaacatcat
atgaaggagatactgacattaatgtcattggatctgtcagacgatagccttgccgatacg
ccacgccgcattgctaaaatgtacgtcgatgaaatattctcaggcttagactatgaaaat
ttccctaagatcacagttatcgacaataaaatgggcttcgatgaaatggtgcgagtgcaa
gatattagcctcaccagcacctgcgaacatcatttagtgacgatcgatggcacagcaacc
atagcttatctgccacgcaaaaaaatcattggtttatcaaagattaatcgtattgtgcgt
ttctttgctcaacgtccacaggtacaggaacgtttaactcaacaggtgttagtcgccctg
caaaccttacttgaaactaaagatgttgcagtaaaaatggatgcagtgcattactgcgta
aagtcccgcggcgtaatggactccaccagttcgaccactaccacagcgctgggcggtatt
tttaaatctaacccagcaactcgcgccgagtttttgcatcaataa

DBGET integrated database retrieval system