KEGG   Shewanella sp. W3-18-1: Sputw3181_0385Help
Entry
Sputw3181_0385    CDS       T00453                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
shw  Shewanella sp. W3-18-1
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:shw00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Sputw3181_0385 (murE)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sputw3181_0385 (murE)
Enzymes [BR:shw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Sputw3181_0385 (murE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
415496..416998
Genome map
AA seq 500 aa AA seqDB search
MMLLRDLLAPWFIYSGDQSFNELTLDSRAIRRGDVFLALPGYRVDGRQFIDKALDLGAAG
VLVHTDDADQHGKVLLGDNAERGVQIYFFQLNRQVSAIAAQRYPLAHQFAVTPSLGIIGI
TGTNGKTSTSQLIAQLVTSLRRKAAVMGTLGNGLWGELVDSGNTTADAITLMRQLHEFEA
QGASVCAMEVSSHGLVQGRVDAVPFDVAVFTNLTRDHLDYHGDMESYATAKQSLFRFSTL
GHGLLNLDDPVGASWLIELKDMAAQIWGFSIEGHQAAAFYTKNTQFDDQGVSTTLVWPEG
ETQIHSPLLGAFNLSNLLAALSALYLQGFDMEALAEQVQYLTPVAGRMERFTTADNITLV
VDYAHTPDAIEQALTALRRHCAGDLWCVFGCGGDRDKGKRPLMGRAAEQYADRIMVTSDN
ARSEDPAQIISDIIQGLVTPERALTQVDRITAIKDVVGLAKSGDLILLAGKGHETYQEAA
GVRHNYDERALARQLAEQSK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgatgttgctacgggacctgttagcgccttggtttatatattcgggtgatcagtctttc
aatgagttgaccttagatagccgcgcaatacgccgcggcgatgtgtttttggcgttgcca
gggtatagggtcgatggcagacagtttattgataaagccttagatttaggtgccgcaggc
gtattagttcacacggatgatgctgaccaacatggcaaagtgttgcttggcgataatgct
gagcgtggtgtgcagatttattttttccaattaaatcgtcaggtatcagcgatagcagcc
cagcgttatcccttagcgcaccagtttgccgttacgccatcccttggcattatcggcatt
accggcaccaatggtaaaacctcaactagtcaactcattgcacagctagtgacgtcattg
aggcgaaaagctgctgttatgggtacattgggaaatggcctatggggtgaactagttgat
agcggtaataccactgccgatgcgattaccctaatgcgtcagttgcatgaatttgaagcc
caaggcgcgagcgtttgtgctatggaagtgtcgagccacgggctagtgcaaggccgcgtc
gatgcagtaccattcgatgtcgccgtgttcactaacttaacgcgcgatcacctcgattac
cacggcgacatggaaagctatgccaccgctaagcagagcctatttcgtttcagtacctta
ggtcacggtttattgaatctcgatgaccccgttggtgcatcttggttgattgagcttaaa
gacatggctgcacagatctggggctttagtatcgaaggccaccaagccgccgctttttat
accaaaaatactcagtttgacgatcaaggcgtaagtacaactttagtgtggcccgagggc
gaaactcaaattcactcaccacttcttggtgcctttaatctctctaatttactcgcggcg
ttatcggccttgtatctgcaaggttttgatatggaagccttagccgagcaagtgcaatat
ttaacgcctgttgcgggtcgtatggagcgttttactacggcggataacatcaccttagtc
gtcgattatgcacatacacccgatgcgatagagcaggcattaacggccttgcgccgccat
tgtgcgggggatttatggtgcgtgtttggttgcggtggagaccgcgataagggcaagcgc
cctttgatggggcgtgccgctgagcaatatgcagaccgtattatggtgaccagtgataat
gcacgcagcgaagatcctgcacaaattattagcgatattatccaagggcttgtcactcca
gaacgagcattgactcaggttgaccgtatcacagcaattaaagacgttgtgggattggct
aaatctggcgatctgatcttacttgcgggcaaaggccacgaaacttaccaagaggcggca
ggcgtgcgtcataactatgatgaacgcgctttggcacgccagttagcggagcaatcaaaa
tga

DBGET integrated database retrieval system