KEGG   Shewanella sp. W3-18-1: Sputw3181_0385Help
Entry
Sputw3181_0385    CDS       T00453                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
shw  Shewanella sp. W3-18-1
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:shw00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:shw00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
415496..416998
Genome map
AA seq 500 aa AA seqDB search
MMLLRDLLAPWFIYSGDQSFNELTLDSRAIRRGDVFLALPGYRVDGRQFIDKALDLGAAG
VLVHTDDADQHGKVLLGDNAERGVQIYFFQLNRQVSAIAAQRYPLAHQFAVTPSLGIIGI
TGTNGKTSTSQLIAQLVTSLRRKAAVMGTLGNGLWGELVDSGNTTADAITLMRQLHEFEA
QGASVCAMEVSSHGLVQGRVDAVPFDVAVFTNLTRDHLDYHGDMESYATAKQSLFRFSTL
GHGLLNLDDPVGASWLIELKDMAAQIWGFSIEGHQAAAFYTKNTQFDDQGVSTTLVWPEG
ETQIHSPLLGAFNLSNLLAALSALYLQGFDMEALAEQVQYLTPVAGRMERFTTADNITLV
VDYAHTPDAIEQALTALRRHCAGDLWCVFGCGGDRDKGKRPLMGRAAEQYADRIMVTSDN
ARSEDPAQIISDIIQGLVTPERALTQVDRITAIKDVVGLAKSGDLILLAGKGHETYQEAA
GVRHNYDERALARQLAEQSK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgatgttgctacgggacctgttagcgccttggtttatatattcgggtgatcagtctttc
aatgagttgaccttagatagccgcgcaatacgccgcggcgatgtgtttttggcgttgcca
gggtatagggtcgatggcagacagtttattgataaagccttagatttaggtgccgcaggc
gtattagttcacacggatgatgctgaccaacatggcaaagtgttgcttggcgataatgct
gagcgtggtgtgcagatttattttttccaattaaatcgtcaggtatcagcgatagcagcc
cagcgttatcccttagcgcaccagtttgccgttacgccatcccttggcattatcggcatt
accggcaccaatggtaaaacctcaactagtcaactcattgcacagctagtgacgtcattg
aggcgaaaagctgctgttatgggtacattgggaaatggcctatggggtgaactagttgat
agcggtaataccactgccgatgcgattaccctaatgcgtcagttgcatgaatttgaagcc
caaggcgcgagcgtttgtgctatggaagtgtcgagccacgggctagtgcaaggccgcgtc
gatgcagtaccattcgatgtcgccgtgttcactaacttaacgcgcgatcacctcgattac
cacggcgacatggaaagctatgccaccgctaagcagagcctatttcgtttcagtacctta
ggtcacggtttattgaatctcgatgaccccgttggtgcatcttggttgattgagcttaaa
gacatggctgcacagatctggggctttagtatcgaaggccaccaagccgccgctttttat
accaaaaatactcagtttgacgatcaaggcgtaagtacaactttagtgtggcccgagggc
gaaactcaaattcactcaccacttcttggtgcctttaatctctctaatttactcgcggcg
ttatcggccttgtatctgcaaggttttgatatggaagccttagccgagcaagtgcaatat
ttaacgcctgttgcgggtcgtatggagcgttttactacggcggataacatcaccttagtc
gtcgattatgcacatacacccgatgcgatagagcaggcattaacggccttgcgccgccat
tgtgcgggggatttatggtgcgtgtttggttgcggtggagaccgcgataagggcaagcgc
cctttgatggggcgtgccgctgagcaatatgcagaccgtattatggtgaccagtgataat
gcacgcagcgaagatcctgcacaaattattagcgatattatccaagggcttgtcactcca
gaacgagcattgactcaggttgaccgtatcacagcaattaaagacgttgtgggattggct
aaatctggcgatctgatcttacttgcgggcaaaggccacgaaacttaccaagaggcggca
ggcgtgcgtcataactatgatgaacgcgctttggcacgccagttagcggagcaatcaaaa
tga

DBGET integrated database retrieval system