KEGG   Shewanella sp. W3-18-1: Sputw3181_0527Help
Entry
Sputw3181_0527    CDS       T00453                                 

Definition
pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase (EC:2.3.1.61)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
shw  Shewanella sp. W3-18-1
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:shw01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:shw00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:shw00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:shw00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
567501..569510
Genome map
AA seq 669 aa AA seqDB search
MAELKEVFVPDIGGDEVQVIEICAAVGDTLAADESIITVESDKATMDIPAPFAGVLAELK
VAVGDKVSEGTLIAMMQAAGAAAADPAPVAAPSSAPAAAPVQAAPAPAVPAATSTQAVET
KVVEVAVPDIGGDTDVSVIEVLVAVGDKIEVDSGLITLETDKATMDVPSPFAGVVKEVKV
AVGDKVSEGSLVIMLEVGGAAPAVAASAPTVAAQAAPAATVAPVAPASATPTASVVTVKE
IQVPDIGDASNVDVIEVLVSVGDMITADQGLITLETDKATMEVPAPFAGKLLSLTVKVGD
KVSQGSVIATVETTAVGAAAPAPVAQAPAVQEVAPVAAQAPASRPPVPHHPSAGAPVSTG
AVHASPAVRRLAREFGVDLTQVTGSGRKGRIMKEDVQAYVKYELSRPKATAATSVGAGNG
GGLQVIAAPKVDFSKFGEVEEIPLSRIQKISGPNLHRNWVTIPHVTQFDEADITEMEEFR
KQQNDAAAKKKADYKITPLVFMMKAVAKTLQQFPVFNSSLSSDGESLIQKKYFHIGVAVD
TPNGLVVPVVRDVDKKGIIELSRELADISIRARDGKLKSADMQGSCFTISSLGGIGGTAF
TPIVNYPDVAILGVSKSEIKPKWNGKEFEPKLMLPLSLSYDHRVIDGAMAARFSVTLSGI
LSDIRTLIL
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atggctgaattaaaagaagtttttgttcctgatatcggcggcgacgaagtgcaagtgatc
gaaatttgtgccgctgtgggtgataccctcgcggccgatgaatcgattattaccgttgaa
agcgacaaggcgactatggatattcctgcgcctttcgccggtgtgttagccgagttaaaa
gtggctgtgggtgataaagtctctgaaggtactttgattgctatgatgcaagcagcgggc
gcggcagctgccgatcctgctccagttgcggcaccatcatccgcgccagcagctgcaccg
gttcaagcggctcctgctcccgcagtaccagcagcgacatcgactcaagctgttgagaca
aaagtcgttgaagtggctgtgccagatatcggtggcgacactgatgtctcggttatcgaa
gtgctggttgccgtcggtgataagattgaggttgatagcggtttaattactctcgaaact
gacaaagcgaccatggatgtaccttcaccttttgctggtgtggtaaaagaagtcaaagta
gccgttggcgataaagtgtcggaaggctctttagtcatcatgcttgaagtgggtggcgca
gctcctgctgtggcagcaagtgcgccaaccgttgccgctcaggcggctcctgccgctacg
gtagcgccagtggctccggcttctgcaactccaactgcaagtgtggttacggtaaaagaa
attcaagtgccagatattggcgatgcaagcaatgtcgatgtgattgaagtgctagtgtct
gtgggcgatatgatcacggccgaccaaggtttaataacccttgaaactgacaaagccacc
atggaagtgccagcgccatttgccggcaaactattgtcgttaaccgttaaagtgggtgat
aaggtttctcaaggtagcgtgatagctaccgttgaaacgactgctgttggagccgctgcg
cctgcgccagttgctcaagcgccagcagtgcaagaagtggcgccagttgctgctcaagca
cctgcaagccgtccgccagtgccgcatcatccaagtgcaggtgcgcctgtgtcgactggt
gcggtacatgcatcgcctgcggtacgccgtttagcccgtgaatttggtgtggatctcacc
caagtcactggttctggccgtaaaggtcgcattatgaaagaagacgttcaggcgtatgtg
aaatacgaactgtcgcgtccgaaagcaactgcggcaacgtcagtcggcgctggcaatggc
ggtggtctgcaagtgattgcagcacctaaagtggatttcagtaagtttggtgaagtggaa
gaaattccattaagccgtatccagaagatctctggccctaacttacaccgcaactgggtg
actattccgcatgtgactcagttcgatgaagctgatatcactgaaatggaagagttccgt
aagcagcaaaacgacgcagcggcgaagaagaaagccgattataagatcacgcctttagtc
tttatgatgaaagcggtggctaagacgttgcaacagttcccagtgttcaactcgagctta
agctctgatggcgaatcactgatccagaagaagtatttccacatcggtgtggcggtggat
acgccaaacggtttggttgtgccagtcgtgcgtgacgtggataagaaaggcattatcgag
ttatctcgtgaactggctgatatctctatccgtgcccgtgatggcaagctgaaatctgct
gatatgcagggcagctgtttcaccatttcaagtttaggtggtattggcggtacggcgttt
acgcctatcgttaactacccagatgtggcgattttaggtgtgtctaaatctgaaattaag
cctaagtggaatggtaaagagttcgagcctaaattgatgttgccactgtcgctatcatac
gatcaccgcgtgatcgatggtgccatggctgcacgctttagcgtgaccctgtcaggaatt
ctgtccgatattcgtactttgattctgtaa

DBGET integrated database retrieval system