KEGG   Shewanella sp. W3-18-1: Sputw3181_0759Help
Entry
Sputw3181_0759    CDS       T00453                                 

Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
shw  Shewanella sp. W3-18-1
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:shw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sputw3181_0759
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Sputw3181_0759
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Sputw3181_0759
Enzymes [BR:shw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Sputw3181_0759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
843234..844997
Genome map
AA seq 587 aa AA seqDB search
MNRTVTRRDFLAMSAKGVGVAVISYGLMGCSDNDDNAVPAQFLHGVASGDPAHDAVILWT
RVTPESQGDVKVSWQVASDAAFSQLVTTGEMVTNASRDYTVKVDARGLRAGQHYFYRFKT
GDKTSALGQTQTLPEGEVSSVKLAVLSCSNFPAGYFNVYELAAAQTDLAAVVHLGDYIYE
YPRGGYASEHAAELGREVLPANELLSLSDYRTRYGQYRTDASLQKLHAKVPFITVWDDHE
VANDTWRDGAENHNEDEGDFTARKEAALQAYFEWLPIRPWREGNHEEIYRSFSYGNLVDL
HMLDTRVLARDKQLDYADYMDATTGTFDGERFLTDVTSTSRTLLGLTQLLWLQGTLLQAT
GKWQVLGQQVLMGKMSLPAAIATQQMSIPQFAMLGALAKLAARAAANDPTLTAQELQYLQ
ANQALLTPEVIALLQLPSIPYNLDAWDGYAYEREVILGTAKSKNLNLVVIAGDTHNAWAS
ELKDMKGDTVGVEFATSSVSSPGLEYYLNLPAEQIPATEAAIVELVPDLKYTNLKDRGFM
TLTFTPDAVRSDWHYVDTILSKDFQLATARSYSAVTKAGEHTINPVS
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtaccgtgactcgtcgtgattttctggctatgtcggccaaaggtgttggcgtt
gctgttatttcctacggcttgatgggctgtagtgataatgatgataatgctgtccccgcg
caatttcttcatggggtagccagcggcgatccagcccatgatgccgttatcctatggact
cgtgtaacacccgagtcacaaggtgatgtgaaagtgagttggcaagtggcgagtgatgcg
gcgttttcacagttagtcaccacgggtgaaatggtgactaatgccagccgtgattacacg
gttaaagtggatgcccgtggtttacgtgcagggcaacactatttttaccgctttaagacg
ggggataaaacttcagcgttaggtcaaacccaaactttgccagaaggtgaagtcagctca
gtaaagttagccgtactttcttgttctaatttccctgcgggttactttaacgtgtatgag
ttagcggcggcgcagaccgatttagctgctgtggtgcacttaggggattacatttacgaa
tatcctcgcggtggttatgccagtgaacatgcggcagaattgggccgagaagtgcttccc
gccaatgagttattgagcttaagcgattatcgtacccgttatggccagtaccgcaccgat
gcgagtttgcaaaaattacatgccaaagtgccttttatcacggtatgggatgaccatgaa
gtcgctaacgatacctggcgtgatggtgctgaaaatcacaacgaagatgaaggggatttt
actgctcgtaaagaagcggcattacaggcttattttgagtggctgcccattcgcccgtgg
cgtgaaggcaaccatgaggagatttaccgcagctttagttacggtaacttagtggattta
catatgctcgatactcgcgtgttagcgcgggataaacagctcgattatgctgattatatg
gatgccactacaggcacctttgatggcgagcgttttcttacggatgtgacatcaacctcg
cgcacgttattaggtttgacacagttattatggttgcaaggtacattattacaggcaacg
ggtaagtggcaggtgttaggtcagcaagtgttaatgggtaaaatgtcattacctgcggcg
attgcgactcagcagatgagcattccccaatttgctatgttaggggctttagctaagtta
gcggcgcgtgcagcggccaatgatcccaccttaacggcccaagaattacaatatctccaa
gccaaccaagccttattaaccccagaagtgatagccctgctgcaattgccatcgattccc
tataacttggatgcctgggatggttatgcctatgagcgtgaagtgattttaggtacggct
aaatcgaaaaatctcaacctagtggtgattgcgggtgatacccataacgcttgggcgagt
gagcttaaagatatgaagggcgatactgttggtgtggagtttgcgacgagttcggtatcc
tcgccggggcttgagtattatttgaatctccctgcagaacagatcccggcaaccgaagcg
gcgattgtcgagttagtgccagatcttaagtacaccaacttaaaagaccgcggctttatg
acgctgacattcactcccgatgcggtgcgcagcgattggcattatgtggacacgattttg
tcgaaggatttccaacttgcaacggcgcgtagttacagtgcggtgacgaaagcaggtgag
cacacgattaatcctgtgagttaa

DBGET integrated database retrieval system