KEGG   Shewanella sp. W3-18-1: Sputw3181_0764Help
Entry
Sputw3181_0764    CDS       T00453                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
shw  Shewanella sp. W3-18-1
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:shw00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Sputw3181_0764
Enzymes [BR:shw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Sputw3181_0764
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(848816..849727)
Genome map
AA seq 303 aa AA seqDB search
MSQILIIGSANADHVMKFEYLPAAGQTLMSREYRLEHGGKGANQAVACARLAKPDTHIDF
ICRLGKDSVGDDMLQSWLKDGISAEGITQTSNMSTGTAMIFIGDNGENTIGVAAGANAEL
LPEDLENYYALFANAQYLLIQLETPLTTVAKALQMAKRLGVTTVLNPAPAKVLGPNYLQW
VDIITPNETEAAALTGVEINHLDDAHLATQLLHQQGVGIVVITLGAKGAYISSPHFTGLI
PAINVQAVDTVAAGDTFNGALVVGLSEGMSIDAAVGFANAASAMTVTRQGAQRAIPYRHE
VPN
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaatactcattatcggcagtgccaatgccgaccatgtgatgaaatttgaatac
ctacccgccgcaggacaaaccttgatgagccgagaataccgtcttgaacacggtggtaag
ggagcaaatcaagcggttgcctgcgcacgtttagccaagccagatacgcacattgatttt
atctgccgcttaggcaaagacagcgtcggcgatgatatgctccaaagctggctaaaagac
ggcattagtgcagaagggatcactcaaacatccaatatgagtactggaacggccatgatt
tttatcggtgacaacggtgaaaataccattggcgttgccgcaggtgctaatgcggagctg
ttacctgaagatttagaaaattattatgccctatttgcgaatgcacagtacctgcttatc
cagttagaaaccccattgacgacggtagcgaaagcgctacaaatggcgaaaagactgggc
gttacgacagtattaaatcctgctccagccaaagtattaggacctaattatcttcaatgg
gtggatattattaccccaaatgaaaccgaagccgcggcactgactggcgtcgagattaat
cacctcgatgatgcgcatcttgcaacacaattgctgcatcaacagggcgtaggtattgtg
gttatcactttaggggcaaagggtgcttatatcagcagtcctcattttaccgggctcata
cccgccatcaatgtacaagccgttgataccgttgcggcgggtgatacctttaatggtgct
ttagttgtcgggttaagtgagggaatgtcgattgatgctgccgtgggatttgccaatgcc
gccagcgccatgacggtgactcgccaaggcgcacaacgggccatcccctaccgccacgaa
gtccctaactag

DBGET integrated database retrieval system