KEGG   Shewanella sp. W3-18-1: Sputw3181_0900Help
Entry
Sputw3181_0900    CDS       T00453                                 

Definition
(GenBank) Phospholipase A(1)
  KO
K01058  phospholipase A1/A2 [EC:3.1.1.32 3.1.1.4]
Organism
shw  Shewanella sp. W3-18-1
Pathway
shw00564  Glycerophospholipid metabolism
shw00565  Ether lipid metabolism
shw00590  Arachidonic acid metabolism
shw00592  alpha-Linolenic acid metabolism
shw01100  Metabolic pathways
shw01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:shw00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Sputw3181_0900
   00565 Ether lipid metabolism
    Sputw3181_0900
   00590 Arachidonic acid metabolism
    Sputw3181_0900
   00591 Linoleic acid metabolism
    Sputw3181_0900
   00592 alpha-Linolenic acid metabolism
    Sputw3181_0900
Enzymes [BR:shw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     Sputw3181_0900
    3.1.1.32  phospholipase A1
     Sputw3181_0900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLA1
Motif
Other DBs
NCBI-ProteinID: ABM23750
JGI: Sputw31810900
Position
complement(1027102..1027983)
Genome map
AA seq 293 aa AA seqDB search
MNLFYKNIPLIGLLMCSGLNAESLVEGRVKDELATAERPFVITPHHVNYLLPATYNPDPN
IAPFLEEMAQDPYTLDKFEAKFQISFKFPVWYNVFGDNGHLFFAYTNQSYWQVYNKETSS
PFRETNHEPEIFMLFNNDWKIGSVTNSFWGFGAVHQSNGKSGLLSRSWNRIYGTMIFDAG
PLAFATKIWWRIPEDEKTDPYQTSGDDNPNIEDYVGNAEFIGVYGIDEHRFTLTLRSNLQ
DIDRGSAELTWSYPIVGNLRLYTQYFNGYGESLIDYNYHNQRIGIGISLNDIL
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaatctgttttataaaaatatcccgttaataggattgctaatgtgctcagggctaaat
gcagaatcattggtagaaggacgcgttaaagatgaacttgctactgcagaacgtccattt
gtgatcaccccgcatcatgtcaattatttactgccagcgacctataatcctgatcctaat
attgctccttttcttgaagaaatggctcaagatccctataccttagataaatttgaggct
aagtttcagataagctttaaatttccggtttggtacaacgtatttggtgacaatgggcat
ctattctttgcttataccaatcaatcctattggcaagtgtataacaaagaaacctcttca
ccctttcgcgaaaccaatcacgaacccgaaatatttatgctgtttaataacgattggaaa
attggcagtgtgaccaattctttttggggttttggtgccgtacatcaatctaatggtaaa
tctggcctactttctcgaagctggaatcggatttatggcaccatgatttttgatgccggt
ccactcgctttcgcaaccaaaatttggtggcgtattcccgaagatgaaaaaaccgatccc
tatcagacaagcggtgatgacaacccaaatattgaagactatgtaggcaatgccgaattt
atcggtgtttatggcattgatgaacacagattcaccctcaccctcagaagcaatctacaa
gatatcgatcgcggctcagcagagctcacgtggagctatccaatagtggggaatttacgt
ctgtatacccaatattttaatggctatggagaaagtttaatcgactacaactatcacaac
caacgtattggaatagggatttcgcttaatgacatcctctaa

DBGET integrated database retrieval system