KEGG   Shewanella sp. W3-18-1: Sputw3181_0971Help
Entry
Sputw3181_0971    CDS       T00453                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
shw  Shewanella sp. W3-18-1
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:shw01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:shw00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1103702..1104820
Genome map
AA seq 372 aa AA seqDB search
MNLSEIAYRRVVVKLGTSVLTSGSKQLDKAHMVELARQMAALMKSGVEVVLCTSGAIAAG
REHLQYPTLPDTMANKQLLAAVGQSQLILAWAQLFSIYGLHVGQLLLTRADLQDRERYLN
ARDTLNALLANNIIPIINENDAVATNEIKVGDNDNLSARAALLCDADLLILLTDQKGLFD
ADPRTNPNAKLISQVVKIDDSLRMLAGGSVSGLGTGGMSTKLEAADIARRAGIEVVIASG
HHPDVIKKVVGKESVGTHFSAIENPLESRKQWILAGPATQGSLVLDAGAVKAVTDKGRSL
LSKGIIGVKGEFERGATLKLVDQQGKVIAKGITRYCGQALNLIAGKHSDEIESVLGYDYG
DAIVHRNDMVVL
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaacttaagtgagattgcgtatcgccgcgtggtagtgaaattgggaacgagtgtgctg
acctctggcagtaaacagctagataaagcccatatggttgagctggctcgtcaaatggct
gcactgatgaagtcaggggtcgaagtcgttttatgcacttcaggggcaattgccgctggg
cgtgaacatctccaatacccgacactgcccgacactatggccaataagcaattgttagcc
gctgtcgggcaaagtcagttgatcctcgcttgggcacaactctttagtatttatgggctg
catgtgggccaactcttgctaacccgcgccgacttgcaggatagagaacgttatctcaat
gctagagatacactcaatgcattgttagcaaataatattatcccgatcattaatgaaaat
gatgccgtggctaccaatgagattaaagtcggtgataatgacaatttatcggcccgcgcg
gcgctgctgtgtgatgctgatttattgattttattgacggatcaaaaggggttgttcgat
gccgatccgcgcactaatccgaatgctaaattgatttcgcaggtggtgaagattgatgac
agtctgcggatgttagcgggggggtctgtatcgggtttaggtacgggcggtatgtcgact
aaactggaagcggcggatattgctcgccgtgcagggattgaggtggtgattgcctctggt
catcaccccgatgtgattaaaaaagtggttggtaaagagtccgttggtactcactttagt
gccattgaaaacccgctcgaaagccgtaaacagtggatattggcgggccctgcgactcaa
ggctctttagtgctcgatgctggcgcggtaaaagccgttaccgataagggccgtagctta
ttatctaaaggtattattggggttaagggcgaatttgagcgcggcgcaacactgaaatta
gttgaccaacaaggtaaagtaattgctaaggggataacgaggtattgtggtcaagccttg
aatttgattgcgggtaaacattccgacgagatcgagtcagtactcggttacgattatggt
gacgcaatagtgcaccgaaacgacatggtggtcctataa

DBGET integrated database retrieval system