KEGG   Shewanella sp. W3-18-1: Sputw3181_1064Help
Entry
Sputw3181_1064    CDS       T00453                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
shw  Shewanella sp. W3-18-1
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:shw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sputw3181_1064
Enzymes [BR:shw01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Sputw3181_1064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1209364..1210197
Genome map
AA seq 277 aa AA seqDB search
MFELIAGTKRLALSSPIVMGILNVTPDSFSDGGQYSSYELACQHADDMVAQGAGMIDIGG
ESTRPGAAEVSLADELARVIPLVKYVAAHHDVWISVDTSKAEVMRQAVAAGAHLINDVRA
LMEPGALEAAAELQVPICLMHMQGDPQSMQFSPTYHNVIEDVSAFLTERIETCLRAGISR
ELLILDPGFGFGKSLEHNYELLAKLDHFSKFDLPILIGLSRKSMIGNLLAKPTSERLAGS
LAGALIAAQKGAHIIRVHDVAQTVDMLKVLQATQAYF
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgaactgattgctggcactaaacgcctcgcattatcttcgcccattgtgatgggt
attcttaatgtcactcccgattctttttccgacggtggtcaatattcttcctatgaatta
gcctgccaacatgccgatgatatggtggctcaaggcgcgggaatgattgatattggcggt
gagtcgacaagaccgggtgccgccgaggtgagcttagccgatgagcttgcgcgggtgatc
ccgttagtgaaatatgttgcggcgcaccacgatgtgtggatttcggtcgataccagtaaa
gctgaagtgatgcgtcaagctgttgctgcaggcgcacatttgattaacgatgtgcgcgcc
ctgatggaacctggagcgcttgaagccgccgcagagttgcaagtccccatatgtctgatg
catatgcaaggtgacccccaaagcatgcagttttctccgacttaccataatgttattgaa
gacgtttctgcctttttaactgaacggattgagacttgtttgcgagcggggatctcccgt
gagttattaatactcgatccgggattcggttttggcaaaagtttagaacataactatgaa
ttactggcaaaactagaccatttttccaagtttgatttaccgatattaataggattatct
cgtaagagcatgataggaaatctcttagcaaaaccgacctcagaacgtcttgctgggagc
cttgctggcgctttgatagcggcccaaaaaggcgctcatatcattcgcgtgcatgatgtt
gcgcaaactgtggatatgctcaaggtgttacaagcgacacaagcgtatttttaa

DBGET integrated database retrieval system