KEGG   Shewanella sp. W3-18-1: Sputw3181_1139Help
Entry
Sputw3181_1139    CDS       T00453                                 

Definition
hypothetical protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
shw  Shewanella sp. W3-18-1
Brite
Enzymes [BR:shw01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Sputw3181_1139
Secretion system [BR:shw02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Sputw3181_1139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1287626..1288318
Genome map
AA seq 230 aa AA seqDB search
MRKLSPIILALALSPLVQAEPVSEVSPVGKIDGMVSLPVTGMKAVESNGRIVFMSDSGRF
VIDGTLYDAWSKKPLTSLEEIREAGNTLDLSRLGLKMDDLNPLTLGEGKKKVVVFVDPRC
PHCHELLKQALPLTKEYTFQILPVPVLGPDSERQVRQLGCARDKKAATDALLNGRIGNLE
QDDACNLEPMQRTLVTAQILGIQGVPFIVANDGRISRGRPYDLSAWLEGR
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaaactatctccaattattctggcgcttgcgctgtctccattggttcaagctgaa
cctgtgtctgaagtgtcgcccgttggcaaaattgacggcatggtttctttacctgtcacg
ggtatgaaagcggtcgaaagcaatggccgtattgttttcatgtcagacagtggccggttc
gtcattgatggcacgctctatgatgcctggtccaaaaagccgcttaccagtcttgaagaa
attcgtgaagcggggaacacgctggacttaagtcgtcttggcttaaaaatggatgatttg
aacccactgacgctgggcgaaggcaaaaagaaagtggtggtctttgttgatccacgatgc
ccgcactgccatgagcttttgaaacaagctttaccgctaaccaaagaatacaccttccaa
atactccctgtgccagtgcttggtcctgattcagagcgtcaggttcgccagcttggctgt
gcgcgtgacaagaaagcggccaccgatgcattgctcaatggccggattggtaacctagaa
caggatgatgcctgcaacttagagccaatgcagcgtaccttggtgacggctcaaatcctg
ggcattcaaggtgtgcctttcatcgtcgccaatgatggtcgcatcagtcgaggccgtcct
tatgatctttctgcttggttggaggggcgttaa

DBGET integrated database retrieval system