KEGG   Shewanella sp. W3-18-1: Sputw3181_1261Help
Entry
Sputw3181_1261    CDS       T00453                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
shw  Shewanella sp. W3-18-1
Brite
Enzymes [BR:shw01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Sputw3181_1261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1433229..1433864
Genome map
AA seq 211 aa AA seqDB search
MTRVALTSAVNLAKKLSDAGIRNQAVLKAISQTPREMFLDNALAHKAYENTALPIGQGQT
ISQPYIVARMTELLLSNMPKKVLEVGTGSGYQAAILAQLVPELCTIERIKGLQIQARQRL
KRLDLHNVSFKYGDGWQGWSNRSPFDAIMVTAAAATVPEALLSQLVDGGVLVLPVGENTQ
QLMRITRHRERFSSENIETVKFVPLVNGELA
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgactcgagttgccttaacatcggcggtgaatctcgctaaaaagctttctgatgcgggg
atccgtaatcaagccgtgttaaaggcgatatcgcaaaccccgcgtgaaatgtttctcgat
aatgcgttagcccataaagcttacgaaaataccgctttgccaattggtcaaggtcaaacg
atttctcagccttatatcgttgccagaatgaccgaactattactcagtaatatgccaaaa
aaggtgctagaagtcggaacggggtcgggttatcaagccgccatattagcccagttagtg
ccagagctttgtacgatagagcgtattaaaggcttacaaattcaagctcggcaaagatta
aaacggctcgatctacataatgtgtcattcaaatatggcgatggctggcaaggatggtct
aaccgtagcccgtttgatgccattatggtgaccgctgccgcagcgacagtacccgaggca
cttttatcccaactggtcgatggcggggtgttagtgttaccagtgggagagaacacacag
caattgatgcggatcacccgtcatcgcgagcgttttagttcagaaaatattgaaacggta
aaatttgtgccattagttaatggtgaattagcataa

DBGET integrated database retrieval system