KEGG   Shewanella sp. W3-18-1: Sputw3181_1271Help
Entry
Sputw3181_1271    CDS       T00453                                 

Definition
DNA polymerase III chi subunit, HolC
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
shw  Shewanella sp. W3-18-1
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:shw00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Sputw3181_1271
   00240 Pyrimidine metabolism
    Sputw3181_1271
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Sputw3181_1271
   03430 Mismatch repair
    Sputw3181_1271
   03440 Homologous recombination
    Sputw3181_1271
Enzymes [BR:shw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Sputw3181_1271
DNA replication proteins [BR:shw03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Sputw3181_1271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1449494..1450024)
Genome map
AA seq 176 aa AA seqDB search
MQGIEIMTQALFYLMPPVAQSGHIAIQSAISTVANTNAALGAMHLFACQLAQQAYIKQQL
VYIHCQDKNLALEIDELLWQFEPTAFVPHNLKGEGPITGAPVEIGFDRLGANKSRQLLIN
IADQAPPFAVNFGQIIDFVANDDQHKAVARERYRQYRDLGIELTTHNLATHPLNLV
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggcattgaaattatgactcaagcgctgttttatctgatgccaccagtggcacaa
tctggtcatatcgcgatccagtcagccataagcactgtagccaataccaatgcggcttta
ggagcaatgcacctttttgcatgtcaattagctcagcaagcttatattaagcaacaatta
gtctatattcattgtcaagacaaaaacttagctttagagattgatgaattattatggcaa
tttgagccaacagcatttgtacctcacaacttgaaaggtgaaggacctatcactggtgcc
ccagttgaaataggttttgaccgccttggggccaataaaagtcgtcaacttctgattaat
attgcagaccaagcccccccatttgcggtaaactttggtcaaatcatcgattttgttgcc
aatgacgatcagcataaagccgttgcccgtgaacgctataggcaatatcgcgacctaggg
atcgaattaacgacccataatttagcaacacatccacttaatttagtttga

DBGET integrated database retrieval system