KEGG   Shewanella sp. W3-18-1: Sputw3181_1271Help
Entry
Sputw3181_1271    CDS       T00453                                 

Definition
DNA polymerase III chi subunit, HolC
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
shw  Shewanella sp. W3-18-1
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:shw00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:shw00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:shw03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:shw03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:shw03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1449494..1450024)
Genome map
AA seq 176 aa AA seqDB search
MQGIEIMTQALFYLMPPVAQSGHIAIQSAISTVANTNAALGAMHLFACQLAQQAYIKQQL
VYIHCQDKNLALEIDELLWQFEPTAFVPHNLKGEGPITGAPVEIGFDRLGANKSRQLLIN
IADQAPPFAVNFGQIIDFVANDDQHKAVARERYRQYRDLGIELTTHNLATHPLNLV
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggcattgaaattatgactcaagcgctgttttatctgatgccaccagtggcacaa
tctggtcatatcgcgatccagtcagccataagcactgtagccaataccaatgcggcttta
ggagcaatgcacctttttgcatgtcaattagctcagcaagcttatattaagcaacaatta
gtctatattcattgtcaagacaaaaacttagctttagagattgatgaattattatggcaa
tttgagccaacagcatttgtacctcacaacttgaaaggtgaaggacctatcactggtgcc
ccagttgaaataggttttgaccgccttggggccaataaaagtcgtcaacttctgattaat
attgcagaccaagcccccccatttgcggtaaactttggtcaaatcatcgattttgttgcc
aatgacgatcagcataaagccgttgcccgtgaacgctataggcaatatcgcgacctaggg
atcgaattaacgacccataatttagcaacacatccacttaatttagtttga

DBGET integrated database retrieval system