KEGG   Shewanella sp. W3-18-1: Sputw3181_1279Help
Entry
Sputw3181_1279    CDS       T00453                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
shw  Shewanella sp. W3-18-1
Pathway
shw00260  Glycine, serine and threonine metabolism
shw00750  Vitamin B6 metabolism
shw01100  Metabolic pathways
shw01110  Biosynthesis of secondary metabolites
shw01120  Microbial metabolism in diverse environments
shw01230  Biosynthesis of amino acids
Module
shw_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:shw00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sputw3181_1279
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Sputw3181_1279
Enzymes [BR:shw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Sputw3181_1279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: ABM24122
JGI: Sputw31811279
Position
1458543..1459826
Genome map
AA seq 427 aa AA seqDB search
MELYNLKHPSQKVSFKEAVQLGLGKDRGLFFPSQIPVLDDIEGLLALPFVERSKKVLGAW
LASELGQDAVDKLVERAFNFDLPLVAVDEQRACLELFHGPTLAFKDFGARFMAQCVNAFV
GDTRLTILTATSGDTGAAVADAFYGLEKVNVVVLYPKGKISELQEKMFTTLGKNIHTVAV
SSDFDACQDLVKRAFDDPEVRDGLSLNSANSINISRLLAQICYYFEAVAQSKQRHEADPV
ISVPSGNFGNLTAGLFAKAMGLPVKRFIAATNANDTVPRYLDNGQWQPNPTQATMSNAMD
VSEPSNWPRVEAICEKLGWPLSNLVGIRLSEEQTSQALVELHAQGYVSEPHAAIAAKALS
LTLVPDEVGIFLGTAHPAKFKDVVDRELTLNLPLPPELEAVASKPILSAELAPDFIKLKA
HLFKVLV
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggaactatataatttaaaacacccttcgcagaaagtgagctttaaagaagcggtacaa
ctggggttaggcaaagacagaggtttgttctttcctagtcagatacccgtactagacgat
attgaagggctgctggcgttgccatttgttgagcgcagtaaaaaagtgctcggtgcatgg
cttgcttctgaattaggccaagatgcggttgataaattagttgagcgtgcctttaacttc
gatttacctttggttgccgtcgatgagcagcgcgcctgccttgaattattccacggtcca
acactggcgtttaaagattttggggcgcgttttatggcgcaatgtgtcaatgcctttgtg
ggtgacacgcgtttaactattttgactgcgacctcgggcgacactggcgcagcggttgcc
gatgccttctatgggcttgagaaagtcaatgtggtggtgctctatcctaagggcaagatc
agtgagctgcaggaaaagatgttcacgacgttgggcaagaatatccatacagtcgctgtc
tcgtccgatttcgatgcctgccaagatctcgttaagcgcgcctttgatgatcccgaagtc
cgtgatggtctgagcctgaattcggctaactctatcaatatcagccgcttactcgcgcaa
atttgttattactttgaagccgttgcccagtctaaacaacgccatgaagccgatcctgtg
atttctgtgccaagtggtaactttggtaacttgaccgcaggtttattcgctaaagccatg
ggattaccggttaaacgctttattgccgcgaccaatgccaacgatacagtgccgcgttat
ttagacaatggccaatggcagcccaatccgactcaagcgactatgtccaatgccatggat
gtgagtgagccaagtaactggccgcgagtggaagccatttgtgagaaattaggctggcca
ctgagtaatttggttgggatccgtttatcggaggaacaaacgtcacaggcgctggtcgag
ttacacgctcaaggttatgtgtctgagccccatgcggcgattgcggctaaggccttatct
ttaactttagtgcccgatgaagtgggcatatttttggggacggcgcatcccgctaagttt
aaggatgttgtggatagggagttaacgcttaacttacccttgccgcccgagcttgaagct
gttgcgagtaagcctatcttatcggcggaattagcacctgattttatcaaattaaaagca
catctatttaaagtattggtttaa

DBGET integrated database retrieval system