KEGG   Shewanella sp. W3-18-1: Sputw3181_1314Help
Entry
Sputw3181_1314    CDS       T00453                                 

Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
shw  Shewanella sp. W3-18-1
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shw00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Sputw3181_1314
   00330 Arginine and proline metabolism
    Sputw3181_1314
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Sputw3181_1314
Enzymes [BR:shw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Sputw3181_1314
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1496466..1497380
Genome map
AA seq 304 aa AA seqDB search
MPELALLEEVVEKVRPLLGQGKVANYIPALASVDAGKLGIAVTTVDGETLGAGDYLEPFS
IQSISKVFSLTLALTLYEEAEIWSRVGKEPSGHSFNSLVQVELERGKPRNPFINAGALVI
ADLLQSRLGAPKHRMLELVRQLSQNDKVCFDKQVADSEYQHSARNAAIAYLMKSFGNFQG
DVDTVLRTYFHYCALKMNCADLSRAMLYLANRGKTVDGTELISQVQTRQLNALLATSGLY
DGAGEFAYRVGMPGKSGVGGGIIAVIPGELSICVWSPELDENGNSLAGTAMLEHLSQRLG
RSIF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagttggcattacttgaggaagtggtcgagaaagttcgacccttgctcggccaa
ggaaaagttgcaaattatatccccgcactggctagcgttgatgctggcaaattaggcatt
gccgtcacgactgttgatggtgaaactttaggtgcgggcgattaccttgagccgttttcg
attcaaagtatctctaaagttttcagcttaaccttagcgttaactttatatgaagaagcc
gaaatctggagccgtgttggcaaagaaccttcgggccattccttcaattctcttgttcaa
gtcgagttagaacgtggcaagccgcgcaatccctttatcaatgctggcgcgttagtgatt
gctgacttattgcagagccgtttaggtgcgcctaaacacagaatgcttgagttagttagg
caactcagccaaaacgataaagtgtgttttgataaacaagtggcagattcagaatatcag
catagtgcgcgcaatgcggctatcgcttatttgatgaagtcgtttggtaattttcaaggc
gatgttgatactgtgctgcgcacttattttcattactgcgccctaaaaatgaattgtgct
gatttatctagggccatgttgtatttggcgaatcgcggcaaaactgtggatggcactgag
ctgatttctcaagttcaaactcggcaacttaacgctctgttggccacctcgggcttatat
gatggcgcgggtgaatttgcttatcgtgttggtatgcctggtaaaagtggcgtcggtggc
ggtattattgcggttatccctggcgagttatcgatttgtgtttggtcaccagagcttgat
gagaatggcaactcacttgcgggtactgctatgcttgagcatctaagtcagcgtcttggg
cgctctattttctag

DBGET integrated database retrieval system