KEGG   Shewanella sp. W3-18-1: Sputw3181_1327Help
Entry
Sputw3181_1327    CDS       T00453                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
shw  Shewanella sp. W3-18-1
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:shw00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Sputw3181_1327
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Sputw3181_1327
Enzymes [BR:shw01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Sputw3181_1327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1509728..1510267
Genome map
AA seq 179 aa AA seqDB search
MNKFTLILAATASIISVGAMAATCPNYLDLEVRKLHSEDKINLCELTQGKPVLIVNTASN
CGYTSQFKSLEAINKEYKDKGLVVIGFPSDDFFQEENDEKDTAKVCYINYGVTFTMLATS
PVRGNDANSVFKYLAEKTGAPKWNFYKYVVSGDGTVVQQFNSKVKPDSAELKQAIESVL
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgaataaattcactctaatattagcagcgacagcaagcatcattagtgtgggagccatg
gccgccacttgcccaaattatctcgatctggaagtacgtaaattacattcagaggataaa
attaatctgtgtgagttgactcaaggtaaacccgtattgatcgtcaatactgccagtaac
tgtggctatacctcacagtttaaatccctagaagctattaataaggaatataaagacaaa
ggattagttgtgataggtttcccatcggatgatttttttcaagaagaaaatgatgagaaa
gacacggcgaaggtatgttacatcaattatggtgtgacttttactatgttggccacatcg
ccggtccgaggaaatgatgcaaacagtgtatttaaatacttggccgaaaaaacgggtgcg
ccaaagtggaatttctataagtatgttgtcagtggtgacggtacagttgtacagcagttc
aattcaaaagtgaaacccgatagtgccgaacttaaacaggctattgaatcggttctttaa

DBGET integrated database retrieval system