KEGG   Shewanella sp. W3-18-1: Sputw3181_1448Help
Entry
Sputw3181_1448    CDS       T00453                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
shw  Shewanella sp. W3-18-1
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:shw00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Sputw3181_1448
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Sputw3181_1448
Enzymes [BR:shw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Sputw3181_1448
Two-component system [BR:shw02022]
 CheA family
  CheA-CheYBV
   Sputw3181_1448
Bacterial motility proteins [BR:shw02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Sputw3181_1448
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1635261..1636379
Genome map
AA seq 372 aa AA seqDB search
MAIKVLVVDDSSFFRRRVSEIVNQDPELEVIATASNGAEAVKMAAELNPQVITMDIEMPV
MDGITAVREIMAKCPTPILMFSSLTHDGAKATLDALDAGALDFLPKRFEDIATNKDDAIL
LLQQRVKALGRRRMFRPIVRPSVLPTPTSRTSTTSVLGNTTPVATAPIRTSTASSIRASG
KQYKLLLIGTSTGGPVALQKILTQFPANYPHPILLIQHMPAAFTPAFANRLNGLCKIEVK
EAANGDLLRPGCAYLAPGGMQMMIERSGASGRIKVIAGSAEMNYKPCVDITFASASKAYG
GDVLAVVLTGMGADGREGARMLKSAGATIWAQDEASCVVYGMPQAVASAGIASQSISLDN
MAESILKESVRG
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggccattaaagtattagtcgttgatgactcaagtttttttaggcgacgtgttagtgaa
atagtcaatcaagatcctgaactggaagtaattgcgacggcctcaaatggggccgaagcg
gtaaagatggctgctgaacttaatccccaagtgattaccatggatattgaaatgcccgtc
atggatggtattactgccgtccgtgagatcatggcaaagtgtccaacacccatattaatg
ttttcatctttgacccatgacggtgccaaagccacgttagatgcgttagatgcgggtgcg
ttagattttttacctaagcgctttgaagatattgcaacaaataaagatgatgccattctt
ttactccagcaaagagtgaaagcccttggtcgcaggagaatgtttcgcccgatagtaaga
ccttcggtgttgccaacgcctacatctcgaacgagtaccacttctgttctggggaacacg
acgcctgttgccactgcgcctattcggacatccacagcttcgtctatccgtgcgagtggt
aaacaatacaaattactgctgattggcacttctactggcggcccagtcgcattgcaaaag
attttgacgcagtttccagccaattatcctcaccctattttactcattcagcatatgccg
gcagcctttacaccagctttcgcgaatcgtctaaatgggttatgtaagattgaagtgaaa
gaagctgcaaatggtgatttacttcgaccaggttgtgcttacttagcgccgggtggcatg
cagatgatgatcgaacgcagtggtgccagtggccgaatcaaagtcatcgcagggagtgct
gagatgaattataagccctgcgtcgatattacttttgcatcagcatcgaaagcctatggt
ggtgatgtacttgctgttgtcttgacgggtatgggagccgatggtcgagaaggagcgcgt
atgcttaaatcggctggagcgactatttgggcacaggatgaagccagttgcgtggtttac
ggcatgccgcaggcagttgcgagtgcgggaattgcgagccaatctatttcactcgacaat
atggctgagtcaattttaaaagagtctgttcgtggctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system