KEGG   Shewanella sp. W3-18-1: Sputw3181_1466Help
Entry
Sputw3181_1466    CDS       T00453                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
shw  Shewanella sp. W3-18-1
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Biosynthesis of antibiotics
Module
dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:shw00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Sputw3181_1466
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Sputw3181_1466
Enzymes [BR:shw01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Sputw3181_1466
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
1657079..1657627
Genome map
AA seq 182 aa AA seqDB search
MKIIDTKIPDVKIIEPRVFGDDRGFFFESFNQQQFEAAIGYPVNFVQDNHSKSSKGVLRG
LHYQLAPHVQSKLVRCVVGEVFDVAVDIRQSSPTFGQWVGVHLSAENKRQLWIPEGFAHG
FVTLRETAEFLYKTTNYYCAASDRGIQWNDEKLAVAWPIEGLILTLSDKDKRQPIFEKAE
YL
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattatcgataccaaaatccccgacgttaagatcatcgagcctagagtctttggc
gatgatcgcggtttcttttttgaaagctttaaccaacagcaatttgaagctgctatcggc
tacccagtcaattttgtccaagacaatcactccaaatcgagcaaaggggtattacgtggt
ctgcattatcaacttgcgccccatgtccaaagcaagctggtgcgttgcgtggttggtgaa
gtttttgacgtggcggtggatattcgccaaagctcacctacatttggccaatgggtgggg
gtgcatctttctgcagaaaataagcgtcaactgtggatccctgaagggtttgcccacggc
tttgttaccttgagagaaacagcggagtttttgtataagacgaccaattactattgcgca
gccagcgatagaggtattcagtggaatgatgaaaaactggcggtagcatggccaattgaa
ggtttgatattgaccttatctgataaagacaaacgacagcccatttttgaaaaggctgaa
tatttgtaa

DBGET integrated database retrieval system