KEGG   Shewanella sp. W3-18-1: Sputw3181_1601Help
Entry
Sputw3181_1601    CDS       T00453                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
shw  Shewanella sp. W3-18-1
Pathway
shw00260  Glycine, serine and threonine metabolism
shw00400  Phenylalanine, tyrosine and tryptophan biosynthesis
shw01100  Metabolic pathways
shw01110  Biosynthesis of secondary metabolites
shw01130  Biosynthesis of antibiotics
shw01230  Biosynthesis of amino acids
Module
shw_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:shw00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sputw3181_1601
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sputw3181_1601
Enzymes [BR:shw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sputw3181_1601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABM24438
JGI: Sputw31811601
UniProt: A1RIE3
Position
complement(1825284..1826474)
Genome map
AA seq 396 aa AA seqDB search
MSTLKLNPYFGEYGGMYVPQILVPALKQLETAFVEAQEDDDFKAEFTDLLKNYAGRPTAL
TLTRNLSPNPMVKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGAGQHGVAT
ALACALLGLKCKVYMGAKDVARQSPNVFRMRLMGAEVIPVTSGSATLKDACNEAMRDWSG
SYEKAHYLLGTAAGPHPFPTIVREFQRIIGEETKKQMLEREGRLPDAVIACVGGGSNAIG
MFADFIDEPSVELIGVEPAGKGIDTPMHGAPLKHGKTGIFFGMKAPLMQDSEGQIEESYS
ISAGLDFPSVGPQHAHLNATGRARYESATDDEALEAFQQLARCEGIIPALESAHAIAYAV
KMARECTKETILVVNLSGRGDKDIFTVSDILNGKEV
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacgttaaagcttaacccttatttcggcgaatacggcggcatgtatgtgccacag
attttagtgccagcccttaagcaattagaaactgcctttgtggaagcgcaggaagatgac
gactttaaagccgaatttaccgatttactgaagaactacgcgggtcgcccaacggcactc
accttaacccgcaatttaagcccaaatcctatggtgaaaatctaccttaaacgggaagat
ttactccacggcggcgcccataaaaccaaccaagtgttaggccaagccctgctggctaag
cgcatgggtaaaaaggaaattattgcagaaactggtgcaggacaacacggcgttgccacc
gcccttgcctgcgcgctgttaggcttaaaatgtaaagtctatatgggcgccaaagatgtt
gcgcgccaatcacctaacgtatttagaatgcgtttgatgggcgcggaagtcattcctgtg
acctcaggttctgccaccctaaaagatgcctgtaacgaggcgatgcgcgactggtctggc
agctacgaaaaggcccactatcttctgggcaccgctgcggggccacatccgttcccaaca
atcgtgcgtgaattccaacgcattattggcgaagaaaccaagaagcaaatgctggaacgt
gaaggtcgcttgcccgatgctgttatcgcttgtgttggcggcggttcgaacgctatcggt
atgtttgctgactttatcgacgaacccagtgtcgaactgattggtgtcgaacctgcgggt
aaaggcatagacacaccaatgcacggcgcgccgcttaaacacggtaagactggtattttc
ttcggcatgaaagcgcctttgatgcaagacagcgaagggcaaatcgaagaatcttactcg
atttcagccggattggacttcccttccgttggcccgcagcacgcacatcttaatgccact
ggccgcgcccgttatgaatcggctaccgatgatgaagccttagaagccttccaacaactg
gcgcgctgtgaagggattatcccagcattggaatcggcgcatgctatcgcctatgccgtc
aaaatggcgcgcgagtgcaccaaggaaaccattttagtggtcaatctttccggtcgtggc
gacaaagatattttcaccgtttctgacattttgaatggtaaagaggtataa

DBGET integrated database retrieval system