KEGG   Shewanella sp. W3-18-1: Sputw3181_1616Help
Entry
Sputw3181_1616    CDS       T00453                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
shw  Shewanella sp. W3-18-1
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:shw00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Sputw3181_1616
Enzymes [BR:shw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Sputw3181_1616
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Sputw3181_1616
Lipid biosynthesis proteins [BR:shw01004]
 Fatty acid synthase
  Component type
   Sputw3181_1616
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1842704..1843303)
Genome map
AA seq 199 aa AA seqDB search
MAKTLGAFILLSMLMATPVHAAKVLILGDSLGASYGMSEQLGWVAMLQKNLPEHQFINGS
VSGETTAGGLRRLPALLDSVSPDLVVVELGGNDGLRGFPPTQLENNLIQIITLAQKSGAK
VLLTEIMVPPNYGPRYTQKFTQVYQDISKTQNIELIPFFMQEIAPYPDLMQRDGIHPNEK
AQAKIAAWMQPWIEKALNQ
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagaccctgggggcattcatcctactgagtatgttaatggctacgccagttcat
gcggcgaaggtactgatccttggcgatagcttaggcgcaagctatggcatgtcggaacaa
ctgggctgggtcgcaatgttgcaaaaaaatctccctgaacatcagtttattaatggttca
gttagcggagaaactaccgcaggcggccttcgccgattacccgctttactcgattctgtc
tctccagatcttgtggtcgttgaactgggagggaatgatggtttacgtggattcccacca
acgcaactcgaaaataatctaatccaaatcattactctagcgcaaaaaagtggcgccaaa
gtattactcaccgaaatcatggtaccgcctaactatggccctcgctatacccaaaagttc
acccaagtgtatcaagacatatccaaaacacagaatattgaattaattccattctttatg
caggaaatcgctccttatccagacttaatgcaacgggatggcattcatcccaatgaaaag
gcccaagcaaaaattgccgcatggatgcaaccttggatagaaaaagccttaaaccaataa

DBGET integrated database retrieval system