KEGG   Shewanella sp. W3-18-1: Sputw3181_1721Help
Entry
Sputw3181_1721    CDS       T00453                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
shw  Shewanella sp. W3-18-1
Brite
Enzymes [BR:shw01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Sputw3181_1721
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1980284..1981285)
Genome map
AA seq 333 aa AA seqDB search
MTKLTSIAIFIAGMFASAHATSAEPIEVIAAAKITEPEKVELGKMLFFEPRLSKSGFISC
NSCHNLSTGGVDALPTSIGHHWQEGPINSPTVLNADFMLAQFWDGRASDLKEQAAGPIAN
PKEMGFTHELATETIASMPAYRARFAKVYGDETVSIDRLTDAIAAFEKTLVTPNSPFDQY
LLGKQEAISADAKAGYQLFKDKGCVSCHNGPAVGGTMFMKMGLIKPFHTNNPAEGRKGVT
GKEGDKFVFKVPTLRNIELTYPYFHDGSVWTLEEAVNTMADIQLGQKLSDKEVKEMVAFL
DSLTGDQPQITLPILPPSNKDTPRPVPFGRSAQ
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgactaaactcacatctatcgctattttcatcgcaggtatgtttgccagcgcccatgcc
accagtgcagagcccattgaggtgatcgccgcggctaagatcactgagccagaaaaagtc
gaattaggtaaaatgctattcttcgaaccacgattatcaaagtctgggtttatctcttgt
aactcatgtcataatttatcgactggcggggttgatgcactaccaacgtcaatcgggcac
cactggcaagaaggtcctattaattcgcccacagtgcttaatgctgattttatgctggct
caattttgggacggccgcgcaagtgatttaaaagagcaagctgctggcccgattgccaac
ccaaaagaaatgggctttacccatgaacttgcaactgaaacgattgcctctatgcctgct
tatcgagcgcgtttcgctaaagtctatggcgatgaaaccgtcagcattgaccgtttaacc
gatgctattgccgcctttgaaaaaaccttagtaactcccaacagtcccttcgatcaatac
ctcttaggcaagcaagaggcgattagcgcagatgccaaagcgggttatcaactgtttaaa
gataagggttgtgtcagttgccataatggtcctgcagtcggtggaaccatgtttatgaag
atgggacttatcaagccgttccacacaaacaatcctgctgaaggtcgtaagggcgttact
ggcaaagagggggataaatttgtatttaaagtacctacattacgtaatattgaactcacc
tatccctacttccatgatggtagcgtatggaccttggaagaagcggtaaataccatggcc
gatatccagctaggacaaaaattatcagataaagaagtgaaagagatggtcgccttcctt
gactctttaacgggtgatcaaccacagattaccttacctatactacccccatcgaataaa
gatacgccgcgtccagttccttttggacgaagtgcgcaataa

DBGET integrated database retrieval system