KEGG   Shewanella sp. W3-18-1: Sputw3181_1740Help
Entry
Sputw3181_1740    CDS       T00453                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
shw  Shewanella sp. W3-18-1
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:shw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sputw3181_1740
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sputw3181_1740
  Amino acid metabolism
   00310 Lysine degradation
    Sputw3181_1740
Enzymes [BR:shw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Sputw3181_1740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2004837..2006039
Genome map
AA seq 400 aa AA seqDB search
MSIEIKVPVLPESVADATIATWHVKVGEHVSRDQNLVDIETDKVVLEVVAPEDGHIGEFL
FQEGDTVLGEQVIAKFIAGAVAGQEVTKAQAEAAAPVAETSDESNDALSPSVRRLLAEHN
VDASKVKGTGVGGRITKEDVEAFVSSASKGAPKAAAPAAPAVAPLAEGRSEKRVPMTRLR
KTIANRLLEAKNSTAMLTTFNEVNMKPIMDIRKQYQDIFEKRHGIRLGFMSFYVKAVTEA
LKRFPEVNASIDGDDIVYHNYFDISIAVSTPRGLVTPVLRDTDTMSLAEIEKAVRDLAIK
GRDGKLTVADMTGGNFTVTNGGVFGSLMSTPILNLPQSAILGMHAIKDRPMAVNGQVEIL
PMMYLALSYDHRIVDGRESVGFLVAIKDFLEDPTRLLLDL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcgaaatcaaggtacccgtactaccagaatctgttgccgatgctacgattgcc
acttggcacgttaaagtgggtgagcatgtttctcgtgatcaaaatcttgttgatattgaa
acagataaagttgtactcgaagtggttgcgcctgaagatggccacattggtgagtttctg
ttccaagagggcgataccgtacttggtgaacaagtgattgctaagttcatcgcgggggct
gttgctggtcaagaagtcactaaagcccaagctgaagcggcagcaccggttgctgaaaca
agtgatgaaagtaatgatgcgttaagtccatctgtacgccgtttactggcagagcacaat
gttgatgctagcaaagtgaaaggtacaggtgtaggcggtcgtatcactaaagaagacgtt
gaagcttttgttagctctgcatcaaaaggggcgcccaaagcagcggctcctgcagcacct
gccgtcgcgccattagcagaaggccgtagtgagaaacgtgtacctatgacacgtttacgt
aaaactatcgctaaccgtctattagaagcgaaaaactctaccgctatgctcacgacgttc
aacgaagtgaacatgaagcccatcatggatatccgtaagcagtaccaagatatctttgaa
aagcgccacggcatccgtttaggttttatgtctttctatgtgaaagcagtgacagaagcc
ctgaaacgcttcccagaagtgaacgcatcaatcgatggtgatgatattgtttatcacaat
tatttcgatattagcattgctgtatcaacaccacgtggtctggtaacacctgtcttacgt
gacacagatactatgagtcttgctgaaattgaaaaagcagtacgcgatctcgctatcaaa
ggccgtgatggcaaactgacggttgccgatatgactggtggtaacttcaccgtgactaac
ggcggcgttttcggttcactgatgtctacaccgatccttaacctgccacaaagtgcgatt
ttaggcatgcatgccattaaagatcgtccaatggcagtcaatggtcaggttgaaatcctg
cccatgatgtacctagcactctcatatgaccatcgtattgttgatggccgtgagtctgtt
ggtttcttggttgcgattaaagacttcctagaagacccaacacgtctgctgctcgatcta
taa

DBGET integrated database retrieval system