KEGG   Shewanella sp. W3-18-1: Sputw3181_1839Help
Entry
Sputw3181_1839    CDS       T00453                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
shw  Shewanella sp. W3-18-1
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:shw00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Sputw3181_1839
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Sputw3181_1839
Enzymes [BR:shw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Sputw3181_1839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2119900..2120928
Genome map
AA seq 342 aa AA seqDB search
MSYLMLDLLSVDVSEAEAEMLRHPQVGGLILFSRNFSSRDQLIRLVQQIRQIRPEILIAV
DHEGGRVQRFRDGFTLIPAMGDILPAAKGDMTLAKRWACELGFLMAIELLACDIDLSFAP
VLDLNGISEVIGKRSFSADPSEVIALADSFIDGMAQAGMGAVGKHFPGHGSVAADSHIAQ
PIDERDAKAIFAKDIFPFKGLIAKGKLSGIMPAHVIYSKVDPHPAGFSHYWLKQVLRQEL
GFTGVIFSDDLGMKGAAFAGDYRARAQAALDAGCDMILVCNDNPGVMSLLDGFSWPENAP
LHPASLLKPNVNQTSLALENLARWENAKQLAEQICLAQKAKA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgagttatttgatgttggatttgctgtctgtagatgtcagtgaggcagaagctgaaatg
ttacgccatccacaggtgggtggtttaattttattttcccgtaatttttcgagtcgtgat
cagttaatccgtctggtacaacagatacgccaaattcgcccagaaattctgatcgcggtc
gatcatgaaggtggtcgggtgcagcgttttcgagatgggtttactcttattcctgcaatg
ggggatattttacccgcggcgaaaggtgatatgacgttagctaagcgttgggcctgtgag
ttaggatttttaatggcaatagaattgctggcctgtgatatcgatttaagctttgcacct
gtacttgatcttaatggcattagtgaagtgatcggtaaacgaagctttagtgcggatcct
agcgaggttatcgcactggcagatagttttattgacgggatggctcaggcgggaatgggc
gcagtaggtaaacattttcccggccatggcagtgtggcggcggattctcatattgcccag
cctattgatgagcgtgatgcgaaggccatatttgctaaggatatttttccctttaaggga
ttgattgctaaggggaaattatctggcattatgcctgcccatgtgatttattctaaagtc
gatcctcatccagcgggattttcacattattggcttaagcaagtgttgcgtcaggaactt
ggttttactggggtgattttctccgatgatttagggatgaagggcgctgcatttgcaggg
gattatcgcgctcgagcccaagctgcccttgatgcagggtgcgatatgatcttagtctgt
aatgataatccgggtgttatgtcgttgcttgatggctttagttggcctgaaaatgcaccg
ttacatcctgcaagtttgttaaaacccaatgttaatcaaacttcactggcactagaaaat
ctggctcgttgggaaaatgcaaaacaattggcggaacaaatttgtttggcacaaaaggca
aaagcttga

DBGET integrated database retrieval system