KEGG   Shewanella sp. W3-18-1: Sputw3181_1916Help
Entry
Sputw3181_1916    CDS       T00453                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
shw  Shewanella sp. W3-18-1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2210111..2211217
Genome map
AA seq 368 aa AA seqDB search
MLPHIQIRSVELTYVIQKINNNMVSIFMFSVENKELDSAAQILRLAVPQMSALDIPVTPE
NYTVWYEYFAGTNLDLNRAIDGFIANGVVFTKEVNTSLYKNFIQEQSPEVIENVQIETQI
LINSLLCKIVQLNQGTADFSGTLAEFGIKLQSNSDINTLNQLVDGVMDEMQNLLINNQNM
EQSLNAMGQEVQHLKSEMENLSLAAMTDQLTSLYNRRAYEIAIQDHIHRAQEQHSRCSLL
IVDIDRFKQFNDTYGHQIGDKVLAYVALALKQCVRGDDFVARYGGEEFVVLLPNTHFHDA
LQVAETLRERISERHLTIGKDKKLSLGAITVSIGLASLQEGDDAETLFSRADKALYEAKS
DGRNCVRG
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgcttccccatatccaaattcgatcagttgagctaacttatgttatacaaaaaattaac
aataatatggtttcaatatttatgttttctgttgaaaataaagaacttgattccgcggcg
caaattttgcggctagccgtgccacaaatgtcggcccttgatatccccgttaccccggaa
aactatacggtttggtatgaatattttgcggggactaatcttgacttaaaccgtgcgatt
gatggttttatcgcaaacggtgttgtgtttacaaaagaggttaatacaagcttatataaa
aattttatccaagaacaatcccccgaggtgattgagaatgtacaaatagagactcagatt
ttaatcaattcattactgtgcaaaattgtacaattgaaccaagggaccgcggatttttcg
ggcactttagcggaatttggcatcaagcttcaatccaattctgacattaataccttaaat
caacttgttgatggtgtgatggatgaaatgcaaaatttactgatcaacaaccaaaacatg
gaacaaagcctaaatgccatggggcaagaggtacaacatcttaagtcggaaatggaaaat
ttaagtctggcggccatgacggatcaattaacgtctttatataatcgccgcgcctatgaa
attgccattcaagaccatattcaccgcgcccaagaacagcattcccgttgtagcttactg
attgttgatatagataggtttaaacaatttaatgatacctatggtcatcaaattggcgat
aaagtattagcttatgtcgcactcgccttaaagcaatgtgttcgaggtgatgactttgtt
gctcgctatggtggcgaagagtttgtagtgcttttgccaaatacccattttcacgatgct
ttacaagttgcggaaaccttaagagaacgtatttcagagcggcacttaaccataggtaaa
gataaaaaattatccctcggcgcaattacagtatcgatcggtcttgcctcattacaagag
ggtgatgatgccgaaacgctctttagccgagcggataaagccttatatgaagctaaatcc
gatgggcgtaactgtgttaggggatag

DBGET integrated database retrieval system