KEGG   Shewanella sp. W3-18-1: Sputw3181_1952Help
Entry
Sputw3181_1952    CDS       T00453                                 

Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
shw  Shewanella sp. W3-18-1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:shw00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:shw00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2258304..2259359
Genome map
AA seq 351 aa AA seqDB search
MSLSISTQQLTHSTFPAPLELITLTNSHGLEVVLSSYGASIWSVKLYEKEDKTIDLSLSY
QNIQDWAINPYYFGITAGRVANRIGGAAFSLKGQTIVLTPNEGNNQLHGGPQGLSHCVWQ
CETKQYSDAVGAIFRIQSPDGDQGYPGDLSVTVEYRLSESNELILIYDALSDQTTPVCLT
NHAYWNLASDKQHGILGHNLQLNASHILALDSEQIPTGELVLVDDTPFDFRQIKSISEDI
HKLSNGYDHYFVMSKDIDNTSCLKTIATLIEPISGRELEISTTELGVQFYSGNFLDGTRL
DNHGKPLNQYQGLCLETHGYPNAVNIAHFPSVMLEENKPYKQITVHRFKNI
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtcactctcaatctctacacaacaattaacgcatagcaccttccctgcaccattagag
ttaataacattaacgaatagtcatggtttggaagtagtgttatcgagttatggtgcaagt
atttggtctgtcaaactctatgaaaaagaagataaaaccattgatctcagtttgagttat
cagaatattcaagattgggcaataaacccttattattttggtattactgcaggccgcgtt
gcaaatcgaattggtggagctgcattttctttaaagggtcaaaccattgtattaaccccg
aatgaaggtaataaccaacttcacggtggtccgcaaggcttaagtcactgtgtttggcaa
tgtgaaactaagcaatattccgatgctgttggtgccatttttaggatacagagtcctgat
ggtgatcaaggttatcctggggatttatccgtaacagtcgaatatcgccttagtgaaagc
aatgagttaatcctgatttacgatgctctatcagaccaaaccactccggtttgtctcaca
aatcatgcctattggaatctcgcatctgacaagcaacatggcatcttaggccataactta
caactcaatgcgagtcatattttagccttagattctgagcaaattcctacgggtgaattg
gttttagtcgatgatacccccttcgattttcgtcaaataaaatccatatctgaagatatt
cataaattaagtaatggttatgaccactattttgtgatgtcgaaggatatagacaatacc
tcatgcttaaaaaccatcgccacattaatcgaacctatttcaggacgtgaattggaaatc
agcactacagaattaggtgtgcaattttatagtggtaactttttagatggtacgcggctt
gataatcatggaaaaccgttaaatcaatatcaaggtttatgtttagaaacccatggttat
cctaatgccgtcaatattgctcattttccgagtgttatgttagaggaaaataaaccctat
aaacaaataacggtgcatagatttaaaaatatttaa

DBGET integrated database retrieval system