KEGG   Shewanella sp. W3-18-1: Sputw3181_2434Help
Entry
Sputw3181_2434    CDS       T00453                                 

Definition
aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
shw  Shewanella sp. W3-18-1
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:shw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sputw3181_2434
Enzymes [BR:shw01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Sputw3181_2434
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2811901..2812749
Genome map
AA seq 282 aa AA seqDB search
MGSVTTQKHANGLDYVEVNTALCQARIFLQGAQIDYFQPVGKPPLLWVSSADDYQPGNGL
RGGVPVCWPWFGMSSEANFPQHGFARTRIWALESVEMRNQLVDLRFSLKISEQDKIYWPH
NTEVSMLFTLGDTLSISLVNTNLDDETVTLTQALHSYFPIEDIHQLKASGFSGSKYIEFA
EGPYPQTTDEVLFDRETDRVYTELGPVQLLHTPQGIIEVSRENSQSAVLWNPWIEKSQRL
GRFNPEDYLTMVCLEAANVLEDKVVLAPGETHSLVTHIRWKD
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgggttcagtcactactcaaaagcacgctaacgggcttgattatgtcgaagtgaatacg
gcgttatgtcaggcaagaatttttttgcagggcgcgcaaatcgactattttcaacccgta
ggcaaaccacctttgctgtgggtttcatcggctgacgattatcaacccggtaatggtctc
cgtggcggtgtccccgtatgctggccttggtttggcatgagtagtgaagcgaactttccc
caacacggtttcgcccgaacccgtatttgggcgctggaatcggtagaaatgcgtaatcag
ttagtggatttacgttttagcttaaaaatcagtgagcaagataaaatctattggccgcat
aacactgaggtcagcatgttattcaccctaggcgataccctaagcattagccttgtgaat
accaacttagacgatgaaaccgtcacgcttacccaagcgctgcacagctatttcccgatt
gaggatatccaccaactcaaggccagcggttttagtggttcaaaatacatcgaatttgcc
gaggggccttatccgcaaaccacggatgaagtgctgtttgatcgcgagacagatcgtgtc
tataccgaactcggccctgtgcagttattgcatacgccgcaggggataatcgaagtcagc
cgtgaaaacagccaatcagcggtattatggaatccatggattgaaaagtcacaacgcctt
ggccgatttaatccagaggattatctgaccatggtctgcctagaagcggccaatgtgtta
gaagataaagtcgtgctcgcgccaggagaaacccacagtttagtgacccacattcgttgg
aaagactaa

DBGET integrated database retrieval system