KEGG   Shewanella sp. W3-18-1: Sputw3181_2716Help
Entry
Sputw3181_2716    CDS       T00453                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase GalU (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
shw  Shewanella sp. W3-18-1
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:shw00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Sputw3181_2716
   00052 Galactose metabolism
    Sputw3181_2716
   00500 Starch and sucrose metabolism
    Sputw3181_2716
   00520 Amino sugar and nucleotide sugar metabolism
    Sputw3181_2716
Enzymes [BR:shw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Sputw3181_2716
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3094555..3095463
Genome map
AA seq 302 aa AA seqDB search
MKQHQIRKAVIPVAGLGTRMLPATKAIPKEMLPVVDKPLIQYVVSEAIAAGIKEIVLVTH
ASKNSIENHFDTSFELEAQLERRVKRQLLEAVQSICPKDVTVISVRQSQAKGLGHAILCA
KSVVGDAPFAVLLPDVIIDDASCNLSKDNLAAMVELFDETQVGQIMVEGVPHNMVNQYGI
ADVNGHDLQPGESEPLVELVEKPPVDEAPSNLAVVGRYVLPASIWPLLAKTPAGAGDEIQ
LTDAIAMLMKQETVNAYYMEGKSHDCGNKQGYMRANVEYALRHSEIGEDFAHYLKNVVKG
IK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacatcaaattcgtaaagccgttattcctgtcgcaggcctaggcactcgtatg
cttcccgcgaccaaagctattcccaaggaaatgctacccgttgttgataagccattgatt
cagtatgtcgtcagtgaagctattgcggctgggatcaaagaaattgtactcgtaactcat
gccagtaaaaactccatcgaaaaccatttcgataccagttttgaattagaagcccagcta
gaacgccgtgtaaagcgtcaactgctagaagctgttcagtctatttgtcctaaagatgta
actgtgatcagtgttcgccaatcccaggctaaaggtttaggtcatgctattttatgtgcc
aaatccgttgtaggtgacgctccttttgccgtattgctacctgacgtcatcatcgatgat
gcaagttgcaacctcagcaaagacaacttggctgcgatggttgagctttttgatgagacg
caagtgggccagatcatggttgaaggtgtgccacacaacatggtcaaccaatacggtatt
gccgatgtgaatggccatgatttacaaccaggtgaatctgaaccattagtcgaactggta
gaaaaaccaccagtagatgaagcgccttctaacttagccgttgttggtcgttatgtatta
cctgccagcatctggccattactggctaaaacacctgcaggtgcgggcgatgaaatccaa
ttaacggatgcgattgcgatgttaatgaagcaagaaaccgtaaatgcttactacatggaa
ggtaagagccacgactgcggtaacaaacaaggttatatgcgtgctaacgttgaatatgcc
ctgcgccacagcgagatcggtgaagattttgcgcactatttaaaaaacgttgtaaaagga
attaaataa

DBGET integrated database retrieval system