KEGG   Shewanella sp. W3-18-1: Sputw3181_2716Help
Entry
Sputw3181_2716    CDS       T00453                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
shw  Shewanella sp. W3-18-1
Pathway
shw00040  Pentose and glucuronate interconversions
shw00052  Galactose metabolism
shw00500  Starch and sucrose metabolism
shw00520  Amino sugar and nucleotide sugar metabolism
shw01100  Metabolic pathways
shw01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:shw00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Sputw3181_2716
   00052 Galactose metabolism
    Sputw3181_2716
   00500 Starch and sucrose metabolism
    Sputw3181_2716
   00520 Amino sugar and nucleotide sugar metabolism
    Sputw3181_2716
Enzymes [BR:shw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Sputw3181_2716
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ABM25535
JGI: Sputw31812716
Position
3094555..3095463
Genome map
AA seq 302 aa AA seqDB search
MKQHQIRKAVIPVAGLGTRMLPATKAIPKEMLPVVDKPLIQYVVSEAIAAGIKEIVLVTH
ASKNSIENHFDTSFELEAQLERRVKRQLLEAVQSICPKDVTVISVRQSQAKGLGHAILCA
KSVVGDAPFAVLLPDVIIDDASCNLSKDNLAAMVELFDETQVGQIMVEGVPHNMVNQYGI
ADVNGHDLQPGESEPLVELVEKPPVDEAPSNLAVVGRYVLPASIWPLLAKTPAGAGDEIQ
LTDAIAMLMKQETVNAYYMEGKSHDCGNKQGYMRANVEYALRHSEIGEDFAHYLKNVVKG
IK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacatcaaattcgtaaagccgttattcctgtcgcaggcctaggcactcgtatg
cttcccgcgaccaaagctattcccaaggaaatgctacccgttgttgataagccattgatt
cagtatgtcgtcagtgaagctattgcggctgggatcaaagaaattgtactcgtaactcat
gccagtaaaaactccatcgaaaaccatttcgataccagttttgaattagaagcccagcta
gaacgccgtgtaaagcgtcaactgctagaagctgttcagtctatttgtcctaaagatgta
actgtgatcagtgttcgccaatcccaggctaaaggtttaggtcatgctattttatgtgcc
aaatccgttgtaggtgacgctccttttgccgtattgctacctgacgtcatcatcgatgat
gcaagttgcaacctcagcaaagacaacttggctgcgatggttgagctttttgatgagacg
caagtgggccagatcatggttgaaggtgtgccacacaacatggtcaaccaatacggtatt
gccgatgtgaatggccatgatttacaaccaggtgaatctgaaccattagtcgaactggta
gaaaaaccaccagtagatgaagcgccttctaacttagccgttgttggtcgttatgtatta
cctgccagcatctggccattactggctaaaacacctgcaggtgcgggcgatgaaatccaa
ttaacggatgcgattgcgatgttaatgaagcaagaaaccgtaaatgcttactacatggaa
ggtaagagccacgactgcggtaacaaacaaggttatatgcgtgctaacgttgaatatgcc
ctgcgccacagcgagatcggtgaagattttgcgcactatttaaaaaacgttgtaaaagga
attaaataa

DBGET integrated database retrieval system