KEGG   Shewanella sp. W3-18-1: Sputw3181_2739Help
Entry
Sputw3181_2739    CDS       T00453                                 

Definition
tRNA(Ile)-lysidine synthetase
Orthology
K04075  
tRNA(Ile)-lysidine synthase [EC:6.3.4.19]
Organism
shw  Shewanella sp. W3-18-1
Brite
Enzymes [BR:shw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.19  tRNAIle-lysidine synthase
     Sputw3181_2739
Transfer RNA biogenesis [BR:shw03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    Sputw3181_2739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3128484..3129881)
Genome map
AA seq 465 aa AA seqDB search
MSVPDLCTHVSVFLDSLKLKAGRKLVLAYSGGVDSEVLAYCLSKYAKQHGELQYQLVYVH
HGLSQHADAWAQHCITRGQHYGLPTIIEHVQVKLGPRMSIEAEARRMRYQAIEQHVGSDD
LLLTAHHEDDQLETILLALKRGQGPKGLAAMGQIQPLMQGIQVRPLLDVSREHIEAYASA
NGLVHIEDESNQDDKYDRNFLRLDIIPRLKARWSSIATTASRSAFLCAEQQTVIDTEVSL
RLPTWLTQAKFTQQTVFNLNGFDSLTPSWQALLLRGFIESQGVALPSFVQLNQIIHQLLN
AKDDAKVLIRVGDCALRRFANQLYLEHYSKHVKSSTEYAKKCIDISESSLSMLINGDIET
LVIPDPQGKNIQFGLSQQGPRLKLPPLNTVVSVRYQLPGQLRCHPHNRSKGRELKKLWQE
YAVPPWLRGQVGFVFYGEQMVMALDLWIEKAFCVEDEAVGLLQHQ
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtccccgatctctgtacccatgtcagtgtttttttagactcacttaaattgaaa
gcgggtagaaagttagtgctggcttacagtggtggtgttgattcagaagtccttgcctat
tgccttagcaagtatgctaaacagcatggggagcttcaatatcaacttgtttatgtgcac
catggtttgagtcaacatgccgatgcttgggcacagcattgcattacacggggacaacat
tatggtctacccacgataattgagcatgttcaagtgaagctgggtccaaggatgagtatt
gaggctgaagctcgcaggatgcgttatcaggcaattgagcagcatgtaggttcagatgat
ctgctgcttaccgcgcaccatgaggacgatcaactcgagacgattctactcgcccttaaa
cgtggtcaaggcccaaaaggattagcggcgatgggacagatccagccgttaatgcagggc
attcaagtgcgacctttattggatgtgagccgtgagcatattgaggcttatgcgagtgct
aatggattggtgcatatcgaagatgaaagtaatcaggatgacaagtatgatcgtaatttt
ttacgtttagacattattcctcgccttaaggctcgttggtcaagtattgccacaacagcg
agtcgcagtgctttcctatgcgctgagcaacaaactgtcattgatacagaggtcagcctc
cgtttacccacttggctcacgcaagcaaaatttacccaacagacggtatttaacctcaat
ggatttgactctttgacaccaagctggcaagcgctattactgcgtggatttatcgagtcg
cagggggttgcattaccctcttttgtgcaacttaatcaaattattcatcagttacttaat
gcaaaagatgatgccaaagtgcttattcgtgtgggcgattgtgcgttgcgccgttttgcc
aatcaactttatcttgagcattattccaagcatgtaaaatcatcaactgaatatgccaag
aagtgtattgatatttccgaaagcagcctaagcatgctcatcaatggtgatattgaaacc
ttagtcatcccagatccccaaggtaaaaatattcaatttggattaagtcaacaaggacca
agactcaagcttccgccattgaatactgtggtgagtgtacgttatcaattaccagggcag
cttcgttgccatccccacaatcgcagtaaaggacgtgaacttaaaaaactttggcaggaa
tacgcagtgccgccatggttacgagggcaggtggggtttgtattttatggcgagcagatg
gtcatggcactcgatctttggattgaaaaggcattttgtgtagaggatgaggctgttggg
ttgctgcagcaccaatga

DBGET integrated database retrieval system