KEGG   Shewanella sp. W3-18-1: Sputw3181_2866Help
Entry
Sputw3181_2866    CDS       T00453                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
shw  Shewanella sp. W3-18-1
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:shw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sputw3181_2866
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sputw3181_2866
   00630 Glyoxylate and dicarboxylate metabolism
    Sputw3181_2866
Enzymes [BR:shw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Sputw3181_2866
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3293282..3295009)
Genome map
AA seq 575 aa AA seqDB search
MVIGDATALEVSVKPVNSGASWEGIKMTEHTLSEQQLNSTLGKAAPNATLDIVGPDIPGQ
EVIFTDGAVALLESLCREFAGEVPVLLAKRKEKQARIDKGGLPDFLPETRAIRDGAWQIR
GIPTDLLDRRVEITGPVERKMVINALNANAKVFMADFEDSLAPSWQKVVEGQINLRDAVR
GDIEYTAPETGKHYKLGPHPAVLICRVRGLHLKEKHVQFNGESIPGSLFDFALYFYHNYR
QLLAKGSGPYFYIPKLESHIEARWWAKVFAFVEERFCLQAGTIKCTCLIETLPAVFEMDE
ILYELRSNIVALNCGRWDYIFSYIKTLKRHSDRVLPDRQAVTMDTPFLSAYSRLLIKTCH
KRGALAMGGMAAFIPAKDPAQNEAVLQRVRRDKELEARNGHDGTWVAHPGLADTAMGIFN
EYIGQDHCNQLHITRDVDAPILAAELLKTCDGERTEQGMRLNIRIALQYLEAWISGNGCV
PIYGLMEDAATAEISRASIWQWIQHGKSLSNGKLVTKQLFKDMLVEELANVKEEVGSDRF
TSGKFTQAAVLLEDITTSDELVDFLTLPGYEMLTA
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
gtggtgattggggatgctactgctttagaagtcagcgttaagcctgtgaatagtggagcc
tcttgggagggcatcaagatgacggaacacactttgagtgagcagcaattgaattcgaca
ctgggtaaagccgcaccaaacgcgacacttgatattgtggggcctgatattcctggacaa
gaggtgatttttaccgacggggctgtagccttactcgaatctctttgccgcgagtttgct
ggcgaggttcctgtgctacttgctaaacgtaaagaaaagcaagctcgcatcgataaaggg
ggattaccagacttcttacctgaaacccgtgctattcgggatggtgcgtggcaaatccgc
gggatcccaacagatcttctcgaccgtagagtcgaaattactggccccgttgaacgtaaa
atggtgatcaatgcgcttaatgctaacgcaaaagtatttatggccgatttcgaggactct
ttagcgccaagttggcaaaaagtggtagaaggccagattaacctgcgtgatgctgttcgt
ggtgatatcgaatataccgcgccagaaacaggtaaacattacaaacttggccctcatccg
gcagtacttatttgccgtgttcgcggcttacatttgaaagaaaagcatgtgcaatttaac
ggtgagtctattcctggttcactgttcgatttcgcactgtatttctatcacaactatcgc
caactcttagcaaagggcagtggtccatacttctatattcctaagttagaaagccatatt
gaagctcgctggtgggcaaaggtgtttgcttttgttgaggaaagattttgtcttcaagca
ggcacaatcaaatgtacttgcctaattgagactttgcctgccgtgttcgagatggacgaa
attctctatgaattgcggtctaatattgtggcgcttaattgtggccgttgggattacatt
ttcagctatatcaaaacattaaaacgccatagcgaccgagtgttacccgatcgtcaagct
gtcactatggatacacccttcttaagtgcttattcaagactcctgattaagacctgccac
aaacgcggtgctttagcgatgggtggtatggcagcctttattccagcaaaagatcccgct
cagaacgaagcagtattgcagcgggttcgtcgggacaaagagcttgaggcgcgtaatggc
cacgatggtacttgggtcgcccatcccggtcttgctgataccgcgatggggatttttaac
gaatatataggtcaagatcattgtaatcaattacatattacccgtgatgtagatgctccc
attctagcggctgagttacttaaaacctgcgatggtgagcgtactgagcaaggtatgcgt
cttaatattcgtattgcgttgcagtatttagaggcgtggattagtggcaatggctgtgta
cctatttatggtttgatggaggacgcggctaccgccgaaatttctagagcctcaatttgg
caatggatccaacatggtaagtcactctctaatggcaagcttgtgactaagcaactcttc
aaggacatgttggtggaagaactcgcgaatgtgaaggaagaagtgggaagtgacagattt
accagtggcaaattcacccaagcggcggtgttactggaagatattactacctctgatgag
ttagtcgatttcttaactttacccggttacgagatgctaacggcttaa

DBGET integrated database retrieval system