KEGG   Shewanella sp. W3-18-1: Sputw3181_2975Help
Entry
Sputw3181_2975    CDS       T00453                                 

Definition
putative oxidoreductase (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
shw  Shewanella sp. W3-18-1
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:shw01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:shw00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3397922..3400045)
Genome map
AA seq 707 aa AA seqDB search
MSDKIGGWAGKVLRVNLTTNHIWYEPINKYYDYIGGMGIGYKILWDNHKDNITATDPDNI
IVFSAGPLTGSGVICTGRTTITSRSPVIEKHLIADGHFGGHFSPAMKFAGFDAIAIEGKA
SSPVWLKIVDDKVTIEPADALWGKGIFDTHAMIAQMMGPNAQVAAIGQAGENQVPLSVIM
TQGGHSAGGHGSVMGSKNCKGIGIIGTGSVKIVANNEKMRALDDHILGIIGANNNGVVPS
TPQSWAEYSAPISRWKARPGLKWGAADQEIELGEVPWNERNRIGFRTSMAESYIGVEYAN
KWMKRTGGCHSCPIRCFCELKVPELKSKYGRKTEHISNVCMGFLVPQYLMGTKNGTEAHA
MAGALGAHILDDYGIWCNYGSISHLFKFLKTKDMFKHLLPEDEFNSIPWALWDNQDPAFL
LDFYRRVAFKEGEISHMADGLYDLIKRWGLDGTNPALGYWDIHKESATKVFNKKTNAAVH
HASETAGQVGTLINVVFNRDAQCHSHINIVNSGLPHDMTVAIAEKKWGEGAFDKVNWYTP
INAAKIRFAKWSLVKNVLHDSLTLCNWMFPLLASPDKNRNYEGDSTIESQMFSLVTGIET
TEAELDFKAERVLHLHRALTVLQMNESNMREEHDVLSDWVYDLNPDKNFGDQGTIKMDRA
DMQKALDMFYEAFGWDIQTGAPTRATLNKFGLGFVADRLAAKGLLPS
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgagtgataaaataggcgggtgggctggtaaagtcctaagagttaatttaacaactaat
catatatggtatgagccaatcaataaatattatgattatattggtggtatgggcatagga
tataaaattctgtgggacaatcataaagacaatataacggcaactgaccctgataatatt
attgtattttccgcaggcccattaacgggttcaggtgttatttgtaccggacgaacaacc
attacttcccgtagtcccgtaattgaaaaacatctgattgctgatggccattttggtggg
catttttcacctgcgatgaaatttgcaggtttcgatgccattgccattgaaggcaaagcc
agcagccctgtgtggcttaaaattgtggatgataaggtcacgattgaacctgccgatgcc
ctatggggtaaaggcatatttgatacccatgcgatgatagcacaaatgatggggcctaat
gctcaggttgccgcaattggtcaagcaggggaaaaccaagtaccactttcagtgataatg
acgcaaggcgggcattcagcgggtggtcatggctctgttatggggtctaaaaattgtaaa
gggatcggtattattggtactggttcggtcaaaattgtcgctaacaatgaaaaaatgcgc
gcattagatgaccatattttagggattatcggcgccaataataatggtgttgtcccttca
acaccgcaatcttgggccgagtactcagcgcctatcagtcgttggaaggctagaccaggg
ctcaagtggggcgctgcagatcaagaaattgaattaggtgaagtgccatggaacgaacgt
aaccgtatcggtttccgtacttcgatggctgaaagttatattggcgtggaatatgccaat
aaatggatgaagcgaactggtggctgtcattcatgccctattcgctgtttctgtgaactt
aaagtccctgaacttaagagtaaatacggccgcaaaaccgaacacatatccaacgtctgt
atgggattccttgtaccacagtatttaatgggcaccaaaaatggtacagaagcacacgcg
atggcgggcgctttaggggcacatattctcgatgactatggtatttggtgtaactatgga
tctatttctcatctatttaaattcttaaaaacaaaggatatgtttaagcatttattacct
gaggatgaatttaacagtattccttgggcactttgggataaccaagatccggctttctta
cttgatttttatcgccgagtggcgtttaaagaaggtgaaatctcccacatggctgacggc
ttatatgatttgattaagcgttggggattagatggaaccaaccccgcattaggttactgg
gatatccacaaagaaagtgcaacgaaagtatttaacaagaaaaccaatgcagccgttcac
catgccagtgaaaccgcaggtcaggttggtacgttaattaacgtggtctttaaccgtgat
gcccagtgccattcccacatcaatatcgttaacagtggtttgccacatgatatgacagtg
gcgattgccgagaaaaaatggggtgaaggtgcattcgataaggtgaattggtatacccca
atcaatgcggccaagatccgttttgccaaatggtcgctggtgaaaaacgtgttacacgat
tcgctgacactatgtaactggatgttcccattgttggcatcaccggataagaatcgtaac
tatgagggtgacagcactatcgaatcgcagatgtttagtttagtgacagggattgaaacc
actgaagctgaattggactttaaagcggaaagagtgctgcatttacaccgtgctttaacc
gtattgcaaatgaatgaaagcaatatgcgcgaagagcatgatgtgctcagtgattgggtt
tatgatttgaatccagataaaaactttggcgatcagggcaccatcaagatggatcgtgct
gatatgcaaaaagcactggatatgttctatgaagcctttggctgggatattcaaaccgga
gccccgactcgagcgacgctcaataagtttggcttagggtttgtagcagatagattagct
gcaaagggcttattaccgagttga

DBGET integrated database retrieval system