KEGG   Shewanella sp. W3-18-1: Sputw3181_3053Help
Entry
Sputw3181_3053    CDS       T00453                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
shw  Shewanella sp. W3-18-1
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:shw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sputw3181_3053
Enzymes [BR:shw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Sputw3181_3053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3482308..3482811)
Genome map
AA seq 167 aa AA seqDB search
MARIYISLGSNIEPVQHLQAGLQSLRECFGPLRLSSMYESEAVGFSGTNFLNMVASAETD
LNIATVVAQFKQIEQNHGRLVGAKKFSPRTLDLDLLLYDDIVCQIPVVLPRAEIVNNAFV
LWPLAELAPNLVHPLVHQTYAKLWNDYDKDSQRLWPVTFEWPCGLTF
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtatttacattagtttaggtagtaatattgagcccgttcagcatttgcaggca
gggttacagtcactcagagaatgctttggtccactcaggctttcttctatgtatgagagt
gaagcggttgggtttagtggcacaaattttttaaatatggtggcaagcgctgaaaccgat
ttgaatattgctacggtagttgcgcagtttaagcaaatcgagcaaaatcacggccgtctt
gttggtgcaaagaagttcagcccaagaacattagatttagatttgttactttatgatgac
atagtatgtcaaattccagtggtgttaccccgggccgagatagttaataacgcttttgta
ttgtggccgttagcggagttagctccaaatctcgttcaccccttagtccaccaaacctat
gcaaaattgtggaatgactacgacaaagattcacagcgactttggcctgtgacgtttgaa
tggccctgtgggctgacgttttaa

DBGET integrated database retrieval system