KEGG   Shewanella sp. W3-18-1: Sputw3181_3090Help
Entry
Sputw3181_3090    CDS       T00453                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
shw  Shewanella sp. W3-18-1
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:shw00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:shw00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3526815..3529517)
Genome map
AA seq 900 aa AA seqDB search
MNKTFAATAILVALGLTACSDVPDAQVVNQAPKPAHASPASEVNAVSGALTQTQLQQLGD
TLTATYRVVTNIPDEQCNKALAEGRCFVAEIDFVPGIDIASHDWSIYFSQMRPVQSVQSD
EFTISHVKGDLYRIAPTAAFTGFSKGVKKTLRFRGELWQLSETDAMPNYYLVAEHLAPVL
IASTQVVQDPETKLEVRPYVEGYTDMVKQYRRTETDKLQPADAARLFINNQAVSEDAALA
TNAIIPTPQKVQVHGTDKAVSLAAGIKVDYQQLDPTLLTPSQVAAALARLARLGVAENDQ
GLAVKLQHSAGNEGSYQLDIKANEINIAAADAAGFSYALSSLASLVDVQDLRVNAMTIED
SPRYPFRGMHIDVARNFHSKQLLLDLLDQMAAYKLNKLHLHMADDEGWRLEIDGLPELTD
IGSQRCHDLAENTCLLPQLGSGPFAESSVNGFYTKQDYIDIVKYAEARQVQVIPSMDMPG
HSRAAIKSMEARYRKLLAEGKAAEAKTYLLSDADDKTVYSSVQYYDDNTLNVCMESTYQF
VDKVIDEIAKLHQAAGQPLTRYHIGADETAGAWKQSPQCLAFVANNDKGVKSIDELGAYF
IERISNQLANKGIEAAGWSDGMSHVRPENMPAKVQSNIWDVIAHKGHSRANQQANLGWET
VLSNPEVLYFDFPYEADPKEHGYYWASRATNSHKVFSFMPDNLAANAEQWTDIQHQPFEA
DDRIKLDEAGKKVSGPREEGKAFSGLQGQIWSETIRSDDTAEYMIFPRLLMLAERAWHQA
AWEVPYQYQGAVYNQNSGAFTLAMREAQAKDWQQLANTLGHKEFIKLDKAGINYRVPTVG
AEIRDGKLFANIAYPGLKLEYRSLNGQWQAYQVGLAVTAPIEIRAIAADGIRKGRSLIVN
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaacatttgccgcgaccgctatactcgtcgcacttggtttgactgcatgttca
gatgtgccagatgctcaggtagtaaatcaggctcccaaacctgcacatgcctcgcctgcc
agtgaggttaacgccgtttcaggtgcattaactcaaactcaattgcagcaattgggggat
accttaacagccacttaccgtgttgtgactaatattcccgatgagcaatgtaacaaagcg
ctggccgagggtcgctgctttgtggccgaaatcgattttgtgccgggaatcgatattgcc
agtcacgactggtcgatttacttcagccaaatgcgtccggtgcaatcggttcagagcgat
gaatttacaatctcccacgtaaagggcgacttataccgcattgcaccgactgcggctttt
accggttttagcaaaggtgtgaaaaagaccctgcgattccgtggtgagttatggcaattg
tcagaaactgatgccatgcctaattactacttagtggccgaacatttagcgccagtattg
attgcgagtactcaggtggtgcaagaccctgaaaccaaattagaagtgcgtccctatgtc
gaaggctacactgacatggtgaagcaatatcgccgcactgaaactgataaattgcaaccc
gctgatgcagcaaggttatttatcaataatcaagcagtaagcgaagatgctgcactagcg
actaatgctattattcctacgccgcaaaaagtgcaagtacatggcaccgataaagccgtg
tctttagctgcgggtattaaagttgattatcaacagcttgatccaacactgctgacgcca
agtcaagttgcggccgcattagcgcgtttagcccgtcttggagtggctgaaaacgatcaa
ggtctagcggttaaattgcagcatagtgcgggcaatgagggcagttatcagctcgatatc
aaggctaacgaaatcaacatcgccgcagccgatgctgccggtttttcctatgcgctatct
tcgctggcgagtttggttgatgtgcaagacttgcgagtcaatgcgatgacgatcgaagat
agtccacgttatccgtttcgtggtatgcatatcgatgtggcacgtaatttccacagcaaa
caattgttgctggatttgctcgaccaaatggcggcttataagctcaataaactgcattta
cacatggctgacgatgaaggttggcgactcgaaatcgacgggttacctgagctgaccgac
atcggtagtcaacgttgtcatgatcttgctgaaaatacctgtttgttaccgcaattgggc
agtggcccttttgcggagtcgagtgttaatggtttctatactaaacaagactatatcgac
atagtgaaatatgctgaggcgcgtcaagttcaagtgatcccatcgatggatatgccgggc
cacagccgagcggcaattaagtcgatggaggcgcgctaccgtaagttactcgccgaaggt
aaagccgctgaggctaagacttatctactttcggatgcggacgataaaaccgtttattcc
tcggtgcagtattacgacgacaacacgctgaacgtatgcatggaatcgacctatcagttt
gtcgataaagtgattgatgagattgccaagttacatcaagccgccggtcagccattaact
cgttatcatatcggtgcggatgaaaccgctggcgcttggaagcaatcgccccagtgtttg
gcgtttgtggccaataacgacaagggcgtgaaatcaatcgacgaattaggcgcttacttt
attgagcgcatttcaaatcagttggcgaataaaggcattgaagcagcgggatggagcgat
ggcatgagccatgttcgccctgagaatatgcccgctaaggtacagtctaatatttgggat
gtgattgcccacaaaggtcattcgcgcgccaatcagcaggcgaatctcggctgggaaacc
gtactttctaatcctgaggtgttgtactttgacttcccctatgaggccgatcctaaagag
catggttattactgggcaagccgagcgaccaatagccataaagtctttagctttatgcct
gataatttagccgctaacgccgagcaatggaccgatattcaacatcagccattcgaagca
gatgacagaataaaactcgatgaggcgggtaaaaaagtctcgggtccaagggaagaaggc
aaagcttttagcggccttcaagggcagatctggagcgagacaattcgcagtgacgatact
gccgagtacatgatatttccacgtttgttgatgctggctgagcgtgcttggcatcaagcc
gcgtgggaagtgccttatcagtatcaaggcgctgtgtataaccaaaactccggagctttt
accttagccatgcgtgaggcacaggcaaaagattggcaacaactcgcgaatactttgggc
cacaaagagtttatcaagctagataaagcgggaattaattatcgcgtaccgacggtcggc
gctgagatccgtgacggtaaactgtttgccaatatcgcctatcccgggcttaaactcgaa
taccgtagtctcaatggccagtggcaagcttatcaagtgggattggcggtcactgcacca
attgagatcagagccattgcggccgatggtattcgtaaaggccgaagtttaatcgttaac
taa

DBGET integrated database retrieval system