KEGG   Shewanella sp. W3-18-1: Sputw3181_3114Help
Entry
Sputw3181_3114    CDS       T00453                                 

Definition
(RefSeq) putative phosphoketolase (EC:4.1.2.9)
  KO
K01621  
xylulose-5-phosphate/fructose-6-phosphate phosphoketolase [EC:4.1.2.9 4.1.2.22]
Organism
shw  Shewanella sp. W3-18-1
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:shw00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Sputw3181_3114
Enzymes [BR:shw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Sputw3181_3114
    4.1.2.22  fructose-6-phosphate phosphoketolase
     Sputw3181_3114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
3556174..3558540
Genome map
AA seq 788 aa AA seqDB search
MTHIHEINALKKYVRATNFLATSQIYLKQNVLHKRPLAHSDIKPRLLGHWGTCPGINFVY
ANINRLIVKHNRPFIYLVGPGHGFPAVQANLFLEGSLSHFYPETIPYNETGIEDICKKFS
AAYGYPSHANPEAPGQILEGGELGYSLSVGWGAVLDNPDLIATVLIGDGESETGPLAASW
YANRLVSPATNGAVLPIVHINGYKISGPTRMGRMSHEELDLEFRGLGYFPIIVDSDAEED
IYVQMTNAMDTAYSMINEIQTRARSGEDVVKPRWPVILMRTAKGWTGVSEYNGVKLEGNC
ESHQVIVNKCATDKGHLDALNNWLASYHFQELYHMNDKGELIFDADICSLIPPKQLACGR
QHLTYGGEVVRALSNPDLEKLCYGPEVPRGQRGFSMLKMGQWMRDAFKLNRDQNNLRIFS
PDETYSNQLQAVFEETDRAWQWPIESWDEDMSRDGRVIELLSENLLFGMLHGYTVTGRHG
MFPTYESFSQVVSSMADQYCKYVYASQGVHFRKPLPACNVVLSSLLERQDHNGYSHQNPS
FLGAMLEKHPKIISAYLPADANSTLVYTERAFADRDKLNILVAGKKELPQWLSLEEARKQ
AKDGVMVWDFASDENPDIVLAGCGDYVTQECMASLVLIRELLPRARIRFVSVTELSSDGL
GSRKFKEKPWLMDEIFTQDKGVVFNYHGYPNTIKKLIFDYKGSRRFRIKGYEEEGSTTTP
FDMGVRNGTSRYHLVIDMAYKLFQQGVIDETQHVSITTDMLQRLVDHRNYIKANGVDPIE
IENWVWTR
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgacacacatccatgaaataaacgctctgaaaaagtacgtcagagcaacaaacttcctt
gccacatcacaaatttacctcaaacaaaatgtcttacataaacgtccactagcacactct
gacataaaaccacgcttactcggtcactggggaacgtgtcctggtatcaactttgtttat
gccaacattaacagactcatcgttaaacataatcgtccattcatctatttagttggccct
ggtcacggtttcccagccgtacaagctaacctattcctcgaaggttccttaagccacttc
taccctgaaacgattccgtataacgaaactggtatcgaagatatctgtaaaaagttttca
gcagcctatggttatccttcacacgcgaacccagaagctccagggcaaatccttgagggg
ggggaattaggctattcactttcagtaggttggggtgccgttctcgataatcctgaccta
atcgccactgttttgattggtgacggtgaatcagaaactggcccactcgcagcgtcatgg
tatgcaaaccgtttagtatcaccggccaccaacggggccgtgcttccaatagtgcatatt
aatggttataaaatttctggtccaactcgtatggggcgcatgagccatgaagagctagat
cttgaattccgaggcttaggttatttccccatcattgttgacagtgacgcagaagaagat
atctatgtgcagatgacaaatgccatggatactgcttacagtatgatcaacgagattcaa
acccgagctcgtagtggtgaagatgtcgtcaaacctcgctggccagtgatcttgatgcgg
acagctaaaggttggacaggcgtgagcgaatacaatggtgtcaagctagagggcaattgc
gaatctcatcaagtcattgtgaataaatgtgcgactgacaaaggccaccttgatgcactc
aataactggctagccagctatcatttccaagagctttatcatatgaatgataaaggtgag
ctgatttttgatgccgatatctgctcattaatcccaccgaaacaacttgcctgtggccgc
caacacttaacctatggtggcgaagtagttagagctttatctaatcccgatcttgaaaaa
ctctgctacggtccagaagttccacgtggtcaacgtggtttttcaatgctgaaaatgggt
cagtggatgcgagatgcatttaagcttaaccgtgatcaaaataatctacgcattttcagt
ccagatgaaacctattcaaaccaattacaagcggtatttgaagaaacagatcgcgcatgg
cagtggccaatcgaaagctgggatgaagatatgtcccgcgatggacgagtgattgaatta
ttatcagagaacttgcttttcggtatgttgcatggctatacagtaacgggacgacatggt
atgttcccaacttatgagtccttctcgcaggtcgtttcatccatggcagatcaatactgt
aagtatgtatatgcaagccaaggtgtccacttccgtaaaccactaccagcatgtaacgtc
gtgctatcttccctcttagagcgtcaagatcacaatggctactcacaccaaaacccttca
tttttaggggcaatgttagaaaaacatccaaaaattatttcggcttatttacctgctgat
gccaacagtactctcgtctatacagagcgcgcatttgccgaccgtgacaagctcaatatc
cttgttgcaggtaaaaaagaactccctcaatggttaagcctagaagaagcccgtaagcaa
gcaaaagacggtgttatggtatgggattttgcttctgacgagaatcccgatattgttctt
gcaggctgcggagactatgtcactcaagaatgtatggcatccttggtattaattcgggaa
ttattaccaagagcaagaattcgcttcgttagtgtaacggaattaagcagtgatggctta
ggtagccgtaagtttaaagaaaagccttggttaatggatgaaatatttactcaagataaa
ggcgttgtatttaactatcatggttatccaaatacaattaaaaagttaatttttgattac
aaaggaagtcgccgttttagaattaaaggatatgaagaagaaggttcaacaaccacacca
ttcgatatgggcgttcgtaatggaacatcacgctatcaccttgttattgatatggcttat
aagttgttccaacaaggcgtaatagatgaaactcagcatgtttcaattaccacagatatg
ctgcagagacttgttgatcatcgcaactatattaaagcaaatggtgttgatccaatcgaa
attgaaaactgggtttggacacgttaa

DBGET integrated database retrieval system