KEGG   Shewanella sp. W3-18-1: Sputw3181_3282Help
Entry
Sputw3181_3282    CDS       T00453                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
shw  Shewanella sp. W3-18-1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3747039..3747764)
Genome map
AA seq 241 aa AA seqDB search
MKLTPALSLVFTLLVAPLASAATTTSPDTAAIKQKLSEMLDVEVISMQDAPVEGLYQAMT
NRGVLYISRDGSKLFHGNVYDIDKGMKNLTEAALAGPRIAMMKPLEDHMLVYKAKNEKHV
ITVFTDVSCGYCRKLHSQMDEYNKLGITVRYLAFPRAGVPSANADEMQAIWCAKDPLKAM
TNAKAGQTVPAATCDAKIAEQYALGTSFGVNGTPAMILADGSMIPGYQPPEDLLRTLDMR
Q
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgaccccagcattatcattggtttttacactccttgttgcaccactcgccagc
gcagcaaccaccacttctcctgatactgctgcgattaagcaaaaactcagtgagatgtta
gatgtcgaagtgatttcgatgcaggatgctccggtggaaggtttgtatcaagccatgacg
aaccgtggcgtactttatattagtcgtgatggctcaaagctattccacggtaatgtatat
gatatcgataaaggcatgaaaaacctgacagaagccgcattagcgggcccacgtatcgcg
atgatgaaaccgcttgaagatcatatgttggtctacaaagccaaaaatgaaaaacatgtc
attaccgtatttaccgatgtcagttgtggttattgccgtaagttacatagccaaatggat
gaatataataagctaggtattacagtacgttatttagcttttccgcgcgcgggtgtgcct
tcggctaatgccgatgagatgcaggctatctggtgtgctaaagatccattaaaagccatg
acgaatgccaaagcgggtcaaacagtgccagctgccacctgtgatgctaaaattgctgag
caatatgcattaggcacaagttttggtgttaatggtacaccagcgatgatcctagccgat
ggcagtatgatcccaggttatcaaccacctgaagatttattacgcaccttagatatgcgc
caataa

DBGET integrated database retrieval system