KEGG   Shewanella sp. W3-18-1: Sputw3181_3377Help
Entry
Sputw3181_3377    CDS       T00453                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
shw  Shewanella sp. W3-18-1
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:shw00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3853203..3854057
Genome map
AA seq 284 aa AA seqDB search
MSAAISRNWPAPAKLNLFLHINGRRTDGYHELQTLFQFIDYCDMLDFKVTDSSELILHSN
MAGVVADSDNLILRAAKSLQQMTSFKGGAEIWLDKRLPMGGGLGGGSSDAATTLVALNTL
WNTQLSTEELAKIGLKLGADIPVFIHGFAAFAEGIGERLQVVSPPEPWYLVIAPDAHVST
AEVFQDPLLPRNTPKLAIDTLMSQAWINDCQKLVVSKYPQVAKALGWLLEYAPSRMTGTG
ACVFGEFTQQQQALAALAKLPSDMQGFVAKGMNISPLITRLNHP
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcagctatctcccgtaattggcccgcgccagccaaacttaatttgtttttgcac
atcaatggccgccgcaccgatggctatcatgagttgcaaaccttgtttcagtttatcgat
tactgcgacatgctggatttcaaggtcactgacagctctgagctgattttgcattcgaat
atggctggcgttgtcgcagatagcgataacttaattctgcgagccgcaaaatcattacaa
caaatgacaagctttaaaggtggagcagaaatctggctagataaacgtctgccgatgggt
ggcggtttaggcggcggttcatcggatgctgccaccacattagtggcactaaacacgtta
tggaacacccaattatcgaccgaagaactggctaaaattggtcttaaattgggtgccgat
attcctgtttttattcatggtttcgcggcttttgccgaaggtatcggtgaacgcttacaa
gtggtatcaccaccagagccttggtatttagttattgcaccagatgcccacgtttccacc
gctgaagtgttccaagatccccttttaccacgtaacaccccaaaacttgccatcgatact
ttgatgagtcaggcgtggataaatgattgccaaaaactggtcgtatctaaataccctcaa
gttgccaaggccttgggctggctgctagaatatgcgccgtcgagaatgaccggaacaggc
gcatgcgtgtttggggaatttacacaacagcaacaagctctcgcagccttggcgaaatta
ccgtctgatatgcaaggatttgttgcaaaagggatgaatatttcgccgcttatcacgcgg
ctcaatcatccgtaa

DBGET integrated database retrieval system