KEGG   Shewanella sp. W3-18-1: Sputw3181_3673Help
Entry
Sputw3181_3673    CDS       T00453                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
shw  Shewanella sp. W3-18-1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:shw00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4193298..4194305
Genome map
AA seq 335 aa AA seqDB search
MNIITSAFPQRRMRRMRKHDFSRRLMAENHLTVNDLIYPMFILEGTNRSEKIASMPGVER
YSIDLLLKEAEELVELGIPLIALFPVTPAEKKTLMAEEAYNADALVQRAVRELKKAFPQL
GIMTDVALDPFTTHGQDGIIDETGYILNDITTDILVKQALSHAEAGADIIAPSDMMDGRI
GAIRQALEAAGHVNTQIMAYSAKYSSSYYGPFRDAVGSAGNLKGGNKHSYQMDPANSDEA
LHEVALDIQEGADMVMVKPGMPYLDIVHRVKTELAVPTFAYQVSGEYAMHMAAIQNGWLA
EKAIVMESLLCFKRAGADGILTYFAKRAAQWLKEA
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
gtgaatattattaccagtgcttttccacagcgcagaatgcgccgcatgcgtaaacatgat
tttagtcgtcgattgatggccgaaaatcatctaacggtcaatgacttgatttacccaatg
tttatccttgaaggcactaatcgtagtgaaaaaattgcctctatgccaggtgtcgaacgc
tactcgatagacttgctactgaaggaggctgaagaactggttgagttaggtattccattg
atcgcacttttccctgtgacacctgcagagaaaaagacattaatggcagaagaagcctat
aacgcagatgccctagtacaacgtgctgtgcgcgagctcaaaaaagcctttccacagctc
ggcatcatgacagacgtggcactagatcccttcaccactcacggtcaagacggcatcata
gacgaaacaggttatatccttaacgatatcacaaccgacattctcgtgaagcaagcgcta
tcgcatgcagaagctggcgcagatatcattgcaccatcagatatgatggatggccgtatt
ggtgcaatacgccaagcacttgaagcggctggtcatgtgaacacccaaatcatggcttac
tcagcaaagtactcatcaagctactatggaccattccgcgatgctgtcggttcagcaggc
aatctaaaaggaggcaataaacacagctaccaaatggatcctgcaaacagtgatgaagca
ttgcacgaagtcgcactggatattcaggaaggtgcagatatggtcatggtcaaacctggt
atgccttatttagatatagtgcatcgtgtcaaaaccgaacttgcagtgccaacattcgct
tatcaagtcagcggtgaatacgccatgcatatggcagcaatccaaaacggttggttggca
gaaaaggcgatcgtgatggagtccctactctgcttcaagcgtgctggagccgatggtatt
ctcacatatttcgccaaacgcgcagctcagtggcttaaagaagcctag

DBGET integrated database retrieval system