KEGG   Shewanella sp. W3-18-1: Sputw3181_3722Help
Entry
Sputw3181_3722    CDS       T00453                                 

Definition
diaminopimelate decarboxylase
Orthology
K01586  
diaminopimelate decarboxylase [EC:4.1.1.20]
Organism
shw  Shewanella sp. W3-18-1
Pathway
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:shw00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sputw3181_3722
  Amino acid metabolism
   00300 Lysine biosynthesis
    Sputw3181_3722
Enzymes [BR:shw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.20  diaminopimelate decarboxylase
     Sputw3181_3722
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4249599..4250843)
Genome map
AA seq 414 aa AA seqDB search
MDHFLYHNNALHAEGCQVADLAKTYGTPLYIYSRATLERHWHAFNNAVMDHPHLICYAVK
ANANLAVLNVLARLGSGFDIVSGGELARVIEAGGSPAKVVFSGVGKTVAEMEQALNLGIY
CFNVESSAELEQLNLVAGRLGKVAPVSLRINPDVDAGTHPYISTGLKENKFGIAMDEAEI
VFARAHALPHLKVKGVDCHIGSQLTEIQPFLDAMDRMLALIDRLAEQGIVIEHFDVGGGL
GVTYDDETPPHPDVYAAALLKRLGNRKLKLIFEPGRAIAANAGIFVTQVLYLKENSDKRF
AIVDGAMNDLIRPALYSAWQNIIPVVPRDSEAYEFDIVGPVCETGDFLGKERKLALAAGD
LLAVRSSGAYGFAMASNYNTRPRAAEVMVDGEHAFLVREREKISQLWQGEQLLP
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
ttggatcactttctctaccataataatgccctgcacgccgaaggctgtcaggttgctgat
ttagccaaaacctatggcacaccactatatatatattcccgtgcgacacttgagcgccat
tggcatgcttttaataatgccgttatggatcatccacacctcatttgttatgcggtcaaa
gccaacgctaacttggccgtactgaatgtgctggcacgtttaggcagtggttttgatatt
gtgtctggcggtgagttggcaagggttatcgaagcaggaggctcccccgctaaagtggtg
ttttctggtgtgggaaaaaccgttgccgagatggagcaagcgcttaatctgggtatttac
tgttttaacgttgaatcaagcgccgagcttgagcagttaaatctggttgcgggtcgttta
ggtaaagtagcacccgtttcattgcggattaatcccgatgtggatgcaggaacccatccc
tatatttcgaccggccttaaggaaaacaaatttggcattgctatggatgaggctgaaatt
gttttcgcccgtgcccatgcgttaccacatctaaaagtgaaaggtgtcgattgtcatatc
gggtcacaactcactgagatccaaccatttcttgatgcaatggatcgtatgctggcgctc
atagatcgtctggctgagcaaggaattgttatcgaacatttcgatgtaggcggtggttta
ggagtgacctatgatgatgaaacgccaccacatcccgatgtatatgcggctgcgttactc
aagcgtttaggcaaccgtaaacttaaactgattttcgagcctggccgtgcgattgcagct
aatgcggggatttttgtcactcaggtgctttatctgaaagaaaacagcgacaagcgtttt
gcgattgtcgatggcgcgatgaatgacctaattcgccccgcactttacagtgcatggcaa
aatattatcccagtagtgccaagagactctgaggcctatgaatttgatattgtaggccct
gtgtgtgaaacaggcgattttctaggtaaagaacgcaagctggctttagctgctggcgat
ctacttgcggtgcgttcaagtggtgcctatggttttgctatggcatccaattacaatact
cgtccccgtgcggctgaagtgatggtcgatggcgagcacgctttcttagtgcgtgagcga
gaaaaaatatctcaactctggcaaggtgagcaactcctgccgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system