KEGG   Shewanella sp. W3-18-1: Sputw3181_3727Help
Entry
Sputw3181_3727    CDS       T00453                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
shw  Shewanella sp. W3-18-1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:shw00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4255107..4255847
Genome map
AA seq 246 aa AA seqDB search
MKVLLTRPEGRNQSMVDALNARGIAHYVTPLLGVEPTNDITTDASHPLAGTDIIICISAN
AVIFANKALNKINAQIATWPKVQYFAVGHATWEALDQLGICAVEAPDDCQQTEGLLTLTS
LQHIPAKKVTIIRGVGGREALAEQLTSRGANVRYWEVYQRVCPPLDGYAITQQWQHFGID
TIVVTSGEVLNNLIKLVPKELFAWLRSCHIIVPSNRVEAQAHAFGINHVTNACAANSKAV
LNALKL
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgttactgacgcgccctgaggggcgcaatcagtctatggtcgatgccttgaat
gcacgaggcattgcccactatgtcacgccattattgggtgttgaaccaactaacgacatc
acaacggatgcttcgcatccattggcagggacagatattattatctgtatcagtgctaac
gctgttatttttgcgaataaagccttaaacaaaattaatgcacaaatagcaacatggcct
aaagttcaatattttgctgtgggccatgcaacatgggaggcattagatcagttaggcatt
tgcgcagttgaagcccccgatgattgccaacaaacggaaggcttacttacccttacttct
ctacaacatattccagctaaaaaagtaacgattatacgtggtgttggtggccgcgaagct
ctcgctgagcaattaaccagccgtggcgcaaatgtacgctattgggaagtatatcagcga
gtgtgtccaccgttagacggatatgctattacacaacaatggcaacactttggtattgat
accattgtggtcaccagtggcgaagttctcaataacctgattaaactagtgccaaaagag
ttatttgcatggctgcgctcatgtcatatcatagtcccaagtaaccgagtagaagctcaa
gctcacgcctttggtataaaccacgtcaccaatgcctgtgccgccaacagcaaagccgtg
ctaaacgcccttaaactttaa

DBGET integrated database retrieval system