KEGG   Shewanella sp. W3-18-1: Sputw3181_3770Help
Entry
Sputw3181_3770    CDS       T00453                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
shw  Shewanella sp. W3-18-1
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:shw00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Sputw3181_3770 (gmk)
Enzymes [BR:shw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Sputw3181_3770 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4317231..4317854
Genome map
AA seq 207 aa AA seqDB search
MTARGNLFIVSAPSGAGKSSLISALLKDKPADMQVSVSHTTRAPRPGEVDGQHYHFVNVE
QFKTLIAENAFFEWAEVFGNYYGTSRHVIEHTLTQGIDVFLDIDWQGAEQVKAVMPEAVG
VFILPPSKAELERRLTGRGQDSQEVIASRMAQAVSEMSHYKEYDFIIINDDFDTALADLR
AIIRSQRLTGASQIHAQNDMLHDLLAG
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacgcggaaatttatttattgtgtcagcgccaagtggtgcgggtaaatcctcg
ctaatttcggcattgttaaaagacaaacctgccgatatgcaggtttcagtatcacatact
acccgcgcgccgcgcccaggtgaagttgatggccaacactaccacttcgttaatgttgaa
caatttaaaacattaatagctgaaaatgcctttttcgaatgggctgaagtattcggtaat
tactatggtacatcacgccatgtgatcgaacatacgctcacccaaggtatcgatgtgttc
ctcgatatcgactggcaaggtgccgagcaggttaaagcggttatgcctgaagccgtaggg
gtatttattttaccgccctcgaaagctgaactagagcgacgcctgactggtcgaggacaa
gacagtcaggaagtgattgccagccgaatggcacaagccgtatcggaaatgtcccactat
aaagaatatgattttattatcatcaatgatgattttgatacagcactggccgatctgcgt
gccatcattcgcagccaacgcttaacaggtgctagtcagatccacgcacaaaatgatatg
cttcacgatctgttggcaggatag

DBGET integrated database retrieval system