KEGG   Schistosoma haematobium: MS3_05076Help
Entry
MS3_05076         CDS       T05004                                 

Definition
(RefSeq) Monoacylglycerol lipase ABHD12
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
shx  Schistosoma haematobium
Brite
Enzymes [BR:shx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     MS3_05076
Peptidases [BR:shx01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   MS3_05076
Exosome [BR:shx04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   MS3_05076
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
Unknown
AA seq 349 aa AA seqDB search
MILLWVSAFLVHLALILYIALPLIVEKFPAFCRRLVFKTHSGPSFGSRVYTHFESVDIPS
GHGHNFYIASLDDKALLGVWHILPSNNEEISATDSRSYEEIMNSLPNDLPVFIYFHGNSK
SRAIPWRVNIYKLLSSLGYHVFCFDYRGYGDSTGSLTGENDCLLDSLTVFQFVCKRFPSA
PIFFWGHSLGTGVVGCLMDHLNKEHDSLPNIRLPKGIILDAPFTCLTDVIHHRIFMKPYQ
LMPTLQERFVSAMNKVKLSFNTQSNLINCPIPIVILHAEDDAVVPFTLGKKLAEILSTNG
TSVFFKPYEGKLGYRHNFIHTAPDLPDIITSFVQSTLSGSLNALEDLII
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgattctgttatgggtgtcagcatttttagtgcacttggctctgatcttgtacatagca
ttaccgttgattgtagagaagtttcctgctttttgtcggcgactagtttttaaaacacac
agtggacctagctttggttcccgagtttatacacactttgaatctgtggacatccctagt
gggcatggccacaatttctacatcgcttctctagatgacaaagctctgttaggagtatgg
catattcttccatcgaataatgaagaaattagtgctaccgattcacggagttatgaagaa
ataatgaattcattgcctaatgatttgcctgtatttatttatttccatggcaattctaaa
tcaagagctattccttggagggtaaacatttataaactattgtcatctcttggctatcac
gttttttgtttcgattacagaggttatggcgattcaactgggtcattaactggagaaaat
gactgtctactggatagtttaacagtttttcaatttgtttgtaaacggtttccttcagcg
ccgattttcttttggggtcattcacttggtactggggttgtcggttgtcttatggatcat
ttaaataaagagcatgattctttaccaaatattcgtcttccaaaaggtattattcttgat
gccccatttacatgcttaactgatgtgatacatcacagaatattcatgaagccttatcaa
ttaatgccaactttacaagaacgatttgtatcggctatgaacaaagtaaaattgtcattt
aatacacagtctaacctaataaattgtcccattccgatagtcatattacacgctgaagat
gatgctgttgtgccattcactttaggaaaaaagcttgctgaaattctttcaactaatggt
acttcagtattcttcaagccgtacgaaggcaaactcggttaccgacataattttattcac
acagcaccagatcttccggatattattacatcatttgttcaatccacattgtctggaagt
ttaaatgcattagaagatttaatcatttga

DBGET integrated database retrieval system