KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_0181Help
Entry
SHJG_0181         CDS       T02063                                 

Definition
glycosyl hydrolase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SHJG_0181
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SHJG_0181
Enzymes [BR:shy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     SHJG_0181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(243545..245170)
Genome map
AA seq 541 aa AA seqDB search
MTGASARLIQSLPQDRRSELMRSLFSTGGDGIGLNYLRQPLGSTDFDASNDHRSYEDTPG
QFSIARDRTEIIPVLRQATSLNPSIRFMGSPWSPPAWMKTSNSLNGGSLKPENYSAYADY
LIRAIRAYQQEGITLTDLTVQNEPEFETSYPSMAMTSTQQADFLRVLDPKLTAAGLATNI
LAYDHNWDHPQYPLDVFSRTSGISRIIGAAFHCYGGQPSDAQQRIVNAGKRVFFTECSGT
DSTNPASTFGDSLRWQAENLVVQNMRSGGETVLTWNLALDQNGGPHQGHCTNRCNGVVEI
ANGTFTRNAEYYSLGHVSKFIKPGATRIGSTSQGAGGVQNVAFENPDGSRAAYVVNTSGG
SQRFSLTDAGRSLAYTLPAGAIATFVWSSTGTPAGPIDSAAWYQVVNANSGACLDAVDWG
TANGTAVQQWTCGTGANQAWQFRPVGDGFYQVVNRHNGKAWDVDGGSGATADGARVHLWD
YVAGTNQQWRPEPVGSSGQYRFVARHSGKCLTVDNSSTANGARVSQQGCNGSSAQAFGLA
G
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
gtgacgggcgcgtcggcacggctgatccagagcctgccgcaggaccggcgcagcgaactg
atgagatcgctgttctccacaggcggcgacggcatcgggctgaactacctgcgccagccc
ttgggcagtacggacttcgatgcatcgaacgaccaccgctcctacgaggacacccctggc
cagttctccatcgcacgagaccgtacggagatcatccccgttctccggcaggcgaccagc
ctcaacccctcgatccgcttcatgggatccccctggtcgccgcccgcgtggatgaagacg
agcaactcactcaacggcggcagcctcaaacccgagaactactcggcgtacgccgactac
ctgatcagggccatcagggcctaccagcaggagggcatcaccctcacggatctcacggtg
cagaacgagccggagttcgaaaccagctatccgtcgatggcgatgacatcgacccagcag
gccgacttcttgcgggtcctggatcccaagctcaccgccgccggactcgctacgaacatc
ctcgcctacgaccacaactgggatcacccccagtatccgctcgacgtcttctctcgcacg
tccggcatcagccgcatcatcggggccgccttccactgctacggcgggcagccctccgat
gcccagcagcgcatcgtcaacgctggcaagcgcgtcttcttcaccgagtgctcgggcacg
gacagcaccaatcccgcttccaccttcggcgacagcctgcgctggcaggccgagaacctc
gtcgtgcagaacatgcgcagcggaggcgagaccgtcctcacctggaaccttgctctcgac
cagaacggcggtcctcaccagggtcactgcaccaaccggtgcaacggagtggtcgagatc
gccaacggcacctttacgcgcaatgccgagtactactccctcggccacgtgagcaagttc
atcaagcccggtgccacccgcatcggctccaccagccagggtgccgggggcgtgcagaac
gtcgccttcgagaaccccgacgggtcccgcgccgcctacgtcgtcaacacgagcggcggc
tcacagcgtttctccctgacggacgccggacggtcccttgcctataccctgcccgccggc
gccatcgccaccttcgtgtggagcagcaccggcacaccggcaggcccgatcgactcggct
gcctggtatcaggtcgtcaacgccaacagcggtgcctgtctggacgcggtcgactggggc
accgccaacggcaccgccgtacagcagtggacatgcggaaccggcgccaaccaggcttgg
cagttccggccggtgggtgacgggttctatcaggtggtcaatcgccacaacggcaaagcc
tgggatgtcgacggcggatccggcgccaccgccgacggagcacgggtccacttgtgggac
tacgtggccggcaccaaccagcagtggcggcccgagcccgtcggctcctcgggtcaatac
cgcttcgtggcccgccacagcggcaagtgcctgaccgtggacaactcctcaaccgcaaac
ggggccagggtgtcgcagcagggctgcaacggatcgagtgcccaggccttcggactggcc
ggctga

  All links  
No link information was found.   
DBGET integrated database retrieval system