KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_0465Help
Entry
SHJG_0465         CDS       T02063                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SHJG_0465
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SHJG_0465
  Lipid metabolism
   00071 Fatty acid degradation
    SHJG_0465
  Amino acid metabolism
   00350 Tyrosine metabolism
    SHJG_0465
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SHJG_0465
   00626 Naphthalene degradation
    SHJG_0465
Enzymes [BR:shy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SHJG_0465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
601887..602846
Genome map
AA seq 319 aa AA seqDB search
MKAFRYVAQGTPLRLMDVPDPVPDAGWVVVDVEAAGLCHSDVHALDGTIELSRRPPFTLG
HEVAGTVSALGEGVREYEVGDRVAVAIIAHPEVQAHYAPGIGVDGGYAERLVAHASTLVR
IPDGVSTVHAAVATDSVVTAYHAVRTEARARPGEVIAVVGLGGLGLNGVRTGVLAGATVY
GVDINPDTFDAARAAGASDCFTDVAALADLRPDAVVDFAGVGSTTSAAVDVVRRRGRVVV
VGLGTRTTGFSTGNLVRKSVELRGSYGASKDEYRQVLDFIAQGRIEPVVEEIPFADLGEG
LDRIRRGAVRGRLAVRPGK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccttccgctacgtggcccagggcacgcccctacggttgatggacgtgccggac
ccggtgccggacgccggctgggtggtggtggacgtcgaggccgccggtctgtgccactcc
gacgtccacgccctcgacggcacgatcgagctgagcaggcgcccgcccttcaccctcggc
cacgaggtcgcgggcaccgtgtccgccctcggcgagggcgtgcgggagtacgaggtgggc
gaccgcgtcgccgtcgcgatcatcgcgcaccccgaggtccaggcccactacgcgccgggc
atcggtgtcgacggcggctacgccgagcgcctggtggcccacgcctccactctcgtccgc
atacccgacggcgtctccacggtccacgcggccgtcgccacggactcggtcgtcaccgcc
taccacgccgtccgcaccgaggcccgcgccagaccgggggaggtgatcgccgtcgtcgga
ctggggggcctcggcctgaacggggtccgaaccggagtgctcgcgggagccacggtctac
ggtgtggacatcaacccggacaccttcgacgcggcccgcgccgcgggggcgagcgactgc
ttcaccgacgtcgccgcactcgccgacctgcggcccgacgccgtcgtcgacttcgcgggc
gtggggtccacgacgtccgccgcggtcgacgtcgtacgccgccgcggccgggtggtcgtc
gtggggctcggcacgaggaccacgggcttctccaccggcaacctggtccgcaagagcgtg
gaactgcgcggctcgtacggcgcgagcaaggacgagtaccggcaggtgctcgacttcatc
gcccagggccgcatcgaaccggtcgtcgaggagatcccgttcgccgacctgggcgaaggc
ctggaccgcatccgtcgcggcgcggtccggggccgtctggccgtccggccgggcaagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system