KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_0579Help
Entry
SHJG_0579         CDS       T02063                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SHJG_0579
   00052 Galactose metabolism
    SHJG_0579
Enzymes [BR:shy01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     SHJG_0579
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(724397..725398)
Genome map
AA seq 333 aa AA seqDB search
MHARKESVGVTAGHPGQGPRPVDAYELDTGDGLAIVVWTYGATLVEVRVPDRHGRQENVV
LRHARLRDYENRRGNPYLGATVGRFCRNIAYGKFTLDGRSYQLDLNDRRHHIHGGSYGFD
RVVWDAELTRTADALTLRLRYLSPDGDQGYPGALAAETSYRVEAGGRLTFEHRATTSAST
IVGFTNHAYWNLAGSGDGGVIDDHRLRLNATHMLPFDDEFLPVAGPVPVHGTAYDFTTAR
RLGRTRIDNFFTLSDPAWAAEMSDPASGRRMRVVTDQPGIGLYSADRYTHSRAGLCLETG
AWPDAANRPEFPSARLDPDGVYTSRTTHHFTVD
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
gtgcacgcacgcaaggaatcggtcggggtcacggccggccaccccggtcaggggccgcgg
ccggtggacgcctacgagctggacaccggggacggtctggcgatcgtggtctggacgtac
ggggcgacgctggtcgaggtgcgcgtgcccgaccgccacggccggcaggagaacgtcgtc
ctgcgccacgcccgtctgcgggactacgagaaccgccgcggcaacccgtacctgggcgcg
accgtgggccggttctgccggaacatcgcctacgggaagttcaccctggacggccggtcc
taccagttggacctcaacgaccgccgccaccacatccacggtggctcgtacggcttcgac
cgtgtcgtctgggacgccgaactgacgcggaccgcggacgcgctcaccctgcggctgcgc
tacctgagcccggacggggaccagggttatcccggcgccctggcggcggagacgagctac
cgcgtcgaagccggcggacgactgaccttcgagcaccgggcgacgacgagcgccagcacg
atcgtcgggttcaccaaccacgcgtactggaacctcgcgggatccggggacggcggtgtc
atcgacgaccaccgactgcggctgaacgccacgcacatgctgccgttcgacgacgagttc
ctgccggtcgcggggcccgtccccgtccacggcaccgcgtacgacttcaccaccgcccgc
aggctcggccggacgcggatcgacaacttcttcaccctctccgatccggcctgggcggcg
gagatgagcgatccggcgagcgggcgccgcatgcgtgtggtgaccgaccagcccggcatc
gggttgtactcggcggaccggtatacccatagccgggccggcctgtgtctggagaccggg
gcctggccggacgcggcgaaccggccggagttcccctccgcccggctggacccggacggc
gtctacacgagtcggaccacgcaccacttcaccgtcgactga

DBGET integrated database retrieval system