KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_0636Help
Entry
SHJG_0636         CDS       T02063                                 

Definition
glycoside hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:shy00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:shy00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
800161..801384
Genome map
AA seq 407 aa AA seqDB search
MTARVRRPGRGRSAALRTGIPLVTMLLTAVACGEPAAHAHTVQPVRAVADPGPRPLATTC
ADRVYSGMTQAQRIGQLFMGGVSAARPSATDLRTLRDYHVGSVMLTGRSSAGTAATRKVV
DGFRGQADTVSGRRVGLMVSTDQEGGQVQVLSGPGFSTIPAALTQGTWSTSTLRSRAAGW
ATQLKSAGVNLDLAPVADVVPASLGTRNAPIGRYNREFGHTPEIVTSHSGAFSAGFKQAH
VMTTLKHFPGLGRVIGNTDTTANVVDSVTTASSSYLDPFRSGIKSGAPFVMVSSATYSKI
DSHHIAAFSPTVIRKLLRTQLGFKGVVISDDLGQAVAVKSFTPGQRAVNFLSAGGNMILT
VKASTVPAMAQAVSARMKTDAAFRADVADSVHRVLDAKSAAGLLSCG
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgacagcacgtgtccgccggccaggaaggggccgttcggcggctctgcgcaccggcatc
ccgctcgtcaccatgctgctgaccgcggtcgcctgcggcgaaccggccgcccacgcgcat
accgtccagccggtccgcgccgtcgccgacccgggcccgcggcccctcgccaccacctgt
gccgaccgcgtctactccggtatgacccaggcacagcgcataggccagctcttcatgggc
ggggtgtccgccgcgcgccccagcgcgaccgatctgcgcacgctgcgtgactaccacgtg
ggctccgtcatgctgaccgggcgcagcagcgccggcaccgcggcgacacgcaaggtggtg
gacggcttccggggccaggcggacacggtctccggccggcgggtgggcctgatggtctcc
acggaccaggagggcggccaggtgcaggtgctgagcggccccgggttctccaccatcccg
gccgcgctcacccagggcacctggtcgacgtcgacgctgcgcagccgggccgcgggctgg
gcgacgcagttgaagtccgccggggtgaacctcgacctcgctcccgtcgcggacgtcgtg
ccggccagcctcggcacgcgcaacgcgcccatcggccgctacaaccgcgagttcggccac
acccccgagatcgtcacctcgcacagcggggccttctccgcggggttcaagcaggcccat
gtgatgacgacgctcaagcacttccccggtctcggccgggtgatcggcaacaccgacacc
accgcgaacgtcgtcgactcggtgacgaccgcctccagttcctacctcgacccgttccgg
tccggcatcaagtccggtgcgccgttcgtgatggtctcctcggccacctactcgaagatc
gactcccatcacatcgcggccttctcgccgacggtcatccgcaaactgctgcgcacccag
ctcggtttcaagggcgtcgtcatctcggacgacctcgggcaggccgtcgcggtgaagtcg
ttcaccccgggccagcgggccgtcaacttcctgtcggcgggcggcaacatgatcctcacc
gtgaaggcgtccaccgtaccggcgatggcacaggcggtcagcgcccgtatgaagaccgac
gccgcgttccgcgccgacgtcgccgacagcgtgcaccgcgtcctcgacgcgaagtccgcc
gccggcctcctcagctgcggctga

DBGET integrated database retrieval system