KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_1118Help
Entry
SHJG_1118         CDS       T02063                                 

Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SHJG_1118
Enzymes [BR:shy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     SHJG_1118
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1335199..1336164
Genome map
AA seq 321 aa AA seqDB search
MRRRLRILVAALFALPSALAVAPSAHAADPTTMTSGFYVDPDSSAKRWVAANPGDGRASA
INASIANTPMARWFGSWSGTIGTATGAFAGAADRSDKLPVLVAYNIYNRDYCGGHSAGGA
ASPSAYASWIAQFAGGIASRPAVVILEPDSLGDYGCMTQAQIDEREAMLTNALAQFSSQA
PNTWVYMDAGNPGWVGPAAMAQRLHEAGLRQAHGFSLNVSNYFTTAENTAFGNAVNSELS
ARYGYTKPFVVDTSRNGNGSNGQWCNPAGRRIGTPTRTGGGAEMLLWIKTPGESDGNCGV
GAGSTAGQFLPEAAYKMIYGY
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgcagactccggatactggtggcagccctcttcgccctgccgtccgcgctcgcc
gtcgcaccgtccgcccacgcggccgacccgaccaccatgaccagcgggttctatgtggac
cccgactccagcgccaagcggtgggtggccgccaatcccggcgacggccgggcgtccgcg
atcaacgcctccatcgccaacaccccgatggcccgctggttcggctcctggagcggcacc
atcggcacggccacgggggcgttcgccggcgcggcggaccgctccgacaagctgcccgtc
ctcgtcgcctacaacatctacaaccgtgactactgcggcgggcactccgcgggcggagcc
gcctcgccgtccgcctacgcgagctggatcgcccagttcgccggcgggatcgcaagccgc
ccggcggtcgtcatcctcgaacccgactccctcggggactacggctgcatgacccaggct
cagatcgacgagcgagaggccatgctcaccaacgccctcgcccagttcagcagccaggcc
cccaacacgtgggtctacatggacgccggcaatccgggttgggtcggtccggcggccatg
gcccagcgcctccacgaagccggcctccgtcaggcccacggcttctcgctcaacgtctcc
aactacttcacgaccgccgagaacaccgctttcggcaatgccgtcaacagtgagctcagc
gcccgctacggctacaccaagccgttcgtcgtggacaccagccgcaacggcaacggctcc
aacggccagtggtgcaaccccgcgggccgccgcatcggcactcccacccgcacgggcgga
ggtgccgagatgctgttgtggatcaagaccccgggcgagtccgacggcaactgcggcgtc
ggagccggctccacggccggacagttcctccccgaggccgcctacaagatgatctacggc
tactga

DBGET integrated database retrieval system