KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_1119Help
Entry
SHJG_1119         CDS       T02063                                 

Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:shy00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1336256..1337530
Genome map
AA seq 424 aa AA seqDB search
MNPRSLRRRAAVVVAALTAGAALTATQAQATPTRDVLTPATKFYVDPHSKAAKQALVDFG
NGDVGNAVNMAKLASWPQAEWFTEGTPDEVRGKVGELVHRARAVGRTPVLVAYNVPGRDC
TQYSSGGAASSAAYRQWIDAFAAGIGTSKAVVVVEPDGTALLPEDCGPTTDPTGELTAAR
IADLAYAVKTLKAKPRTVVYLDAGNVQWRPVGEMAQRLLDAGVRHSDGFALNVSNTHPTD
HNARYGTWIAKCMWYATEGPEEARGHAERCAGQYYSAAAPNDGTPGNAVSSTDPTTWRWT
DAWYDQNVGTPPADGLRHFVIDTSRNGLGAWTPEPGKYTGDPEVWCNAPGRGLGPRPTAD
TGVPLVDAYLWIKIPGESDGSCTRNTGGTIDPEYGVVDPPAGTWWPDQAHALARNAAPRL
AFNR
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaatccacgcagccttcggcgccgcgcggccgtcgtcgtcgcggccctcaccgcgggc
gccgctctcaccgcgacgcaggcgcaggccacacccacgcgggacgtgctcaccccggcc
acgaagttctatgtggacccgcacagcaaggccgcgaagcaggccctcgtggacttcggg
aacggcgacgtcgggaacgccgtgaacatggccaagctcgccagctggccgcaggccgag
tggttcaccgagggcacgcccgacgaggtgcgcggcaaggtcggcgagctcgtccaccgg
gcccgggccgtgggccgtaccccggtgctggtcgcctacaacgtcccgggccgggactgc
acgcagtactccagcggcggagccgcatcctccgccgcctaccggcagtggatcgacgcc
ttcgccgccggcatcggcaccagcaaggcggtggtcgtcgtcgaacccgacggcacggcc
ctcctccccgaggactgcggacccaccaccgacccgacaggcgaactcaccgccgcccgc
atcgccgacctggcctacgccgtgaagaccctgaaggccaagccgcgcacggtggtctac
ctggacgcgggaaacgtccagtggcggcccgtcggtgagatggcccagcggctgctggac
gccggggtccggcacagtgacggcttcgccctcaacgtgtccaacacccaccccaccgac
cacaacgccagatacggcacctggatcgccaagtgcatgtggtacgccaccgaggggccc
gaggaggcgcgtggccacgccgagcggtgcgccggccagtactactcggcggctgccccg
aacgacggcacccccggcaacgcggtctcctccaccgacccgaccacctggcggtggacc
gacgcctggtacgaccagaacgtgggcaccccgccggccgacgggctgcgtcacttcgtg
atcgacaccagccgcaacggcctgggcgcctggaccccggagccgggcaagtacacgggg
gatccggaggtctggtgcaacgcacccggccgcggtctcggcccgcgccccaccgccgac
accggcgtacctctcgtcgacgcctatctgtggatcaagatccccggcgagtccgacggt
agctgcacgcgcaacaccggcggcaccatcgaccccgagtacggcgtcgtggacccgccc
gccggcacctggtggcccgaccaggcccacgccctggcccgcaacgcggcaccgcgcctg
gccttcaaccgctga

DBGET integrated database retrieval system