KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_2084Help
Entry
SHJG_2084         CDS       T02063                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:shy00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2540669..2542183
Genome map
AA seq 504 aa AA seqDB search
MVERYVMSVDQGTNSTRCILFDHRGRLVSVAQKEHQQHFPKPGWVEHDAVEIWQNLRRVV
PEALSDAGVDQGQIAAIGLANQRETTVLWDRRTGAPLGRALVWQDTRTAPLVDALGEDPG
EAFFLDRCGLPPSTYFSALRIRWLFDHVKGVEQRARDGEVLFGTMESWLIWNLTGGTDGG
LHITDVTNASRTMLMNIRKLAWDEELLDFFRVPRSMLPEIRSSAEPYGEARSLLPGVSIT
AALGDQQAALFGQTCFSPGDAKCTYGTGSFLLLNTGSDLVRSRHGLLTTVAYKIGDQQPA
YALEGSIAVTGALVQWFRDRLGLISSAPEIETLARTVEDNGGCYIVPAFSGLFAPRWRSD
ARGVIVGLTSYITKGHLARAVLEATGWQTREVVDAMNADSSVALHQLKVDGGMTADNLLM
QFVADVLDVPVVRPMVAETVSLGAAYAAGLAAGYWSDLEVLRRNWHKAGQWLPAMDPERR
EAEYDNWQRAVERSLGWVRPPRPS
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggttgaacggtatgtgatgtccgtcgatcagggcaccaattcgacccgctgcatcctg
ttcgaccaccgtgggcggctggtgtcggtcgcgcagaaggagcaccagcagcacttcccg
aagcccggatgggtcgagcacgacgccgtcgagatctggcagaacctgcggcgcgtggtg
cccgaggccctgtcggacgccggggtggaccagggccagatcgcggcgatcggcctggcc
aaccagcgggagacgacggtgctctgggaccggcggaccggcgcgccgctcggccgggcg
ctcgtgtggcaggacacccgtacggcgccgctcgtcgacgccctcggagaggaccccggg
gaggcgttcttcctcgaccggtgcggcctgccgccgtcgacctacttctccgcgctgcgc
atccggtggctgttcgaccacgtcaagggggtcgagcagcgcgcccgggacggcgaggtg
ctgttcggcacgatggagagctggctgatctggaacctcaccggcggaaccgacggcggt
ctgcacatcaccgacgtgaccaacgccagccggacgatgctgatgaacatccgcaagctc
gcctgggacgaggagctgctggacttcttccgggtgccgcgctcgatgctgcccgagatc
aggtcgtccgccgagccgtacggcgaggcccgctcgctgctgccgggcgtctccatcacg
gccgcgctcggcgaccagcaggccgccctgttcggccagacctgcttctccccgggcgat
gccaagtgcacctacggaacgggcagcttcctgctgctcaacaccgggtccgacctggtg
cggtcccggcacgggctcctcacgacggtcgcctacaagatcggggaccagcagccggcc
tacgccctggaagggtcgatcgccgtcaccggcgcgctcgtccagtggttccgtgaccgt
ctggggctgatcagcagcgcgccggagatcgagaccctcgcccggacggtcgaggacaac
ggcggctgctacatcgtcccggccttctcgggcctgttcgcgccgcgctggcgcagcgac
gcgcgcggggtcatcgtcgggctcacctcgtacatcaccaagggacacctggcgcgggcc
gtcctggaggccaccgggtggcagacccgggaggtcgtcgacgccatgaacgccgactcc
tcggtcgccctccaccagctcaaggtggacgggggcatgaccgcggacaacctgctcatg
cagttcgtggccgacgtgctcgacgtgccggtggtacggccgatggtcgccgagacggtc
tcgctgggcgccgcttacgcggccgggctcgccgccggctactggtccgacctggaggtg
ctgcgccgcaactggcacaaggccggccagtggctgcccgccatggaccccgagcggcgg
gaggcggagtacgacaactggcagcgggccgtcgagcgctccctgggctgggtccggcca
ccacggccctcctga

DBGET integrated database retrieval system