KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_2084Help
Entry
SHJG_2084         CDS       T02063                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    SHJG_2084
Enzymes [BR:shy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     SHJG_2084
Exosome [BR:shy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SHJG_2084
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2540669..2542183
Genome map
AA seq 504 aa AA seqDB search
MVERYVMSVDQGTNSTRCILFDHRGRLVSVAQKEHQQHFPKPGWVEHDAVEIWQNLRRVV
PEALSDAGVDQGQIAAIGLANQRETTVLWDRRTGAPLGRALVWQDTRTAPLVDALGEDPG
EAFFLDRCGLPPSTYFSALRIRWLFDHVKGVEQRARDGEVLFGTMESWLIWNLTGGTDGG
LHITDVTNASRTMLMNIRKLAWDEELLDFFRVPRSMLPEIRSSAEPYGEARSLLPGVSIT
AALGDQQAALFGQTCFSPGDAKCTYGTGSFLLLNTGSDLVRSRHGLLTTVAYKIGDQQPA
YALEGSIAVTGALVQWFRDRLGLISSAPEIETLARTVEDNGGCYIVPAFSGLFAPRWRSD
ARGVIVGLTSYITKGHLARAVLEATGWQTREVVDAMNADSSVALHQLKVDGGMTADNLLM
QFVADVLDVPVVRPMVAETVSLGAAYAAGLAAGYWSDLEVLRRNWHKAGQWLPAMDPERR
EAEYDNWQRAVERSLGWVRPPRPS
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggttgaacggtatgtgatgtccgtcgatcagggcaccaattcgacccgctgcatcctg
ttcgaccaccgtgggcggctggtgtcggtcgcgcagaaggagcaccagcagcacttcccg
aagcccggatgggtcgagcacgacgccgtcgagatctggcagaacctgcggcgcgtggtg
cccgaggccctgtcggacgccggggtggaccagggccagatcgcggcgatcggcctggcc
aaccagcgggagacgacggtgctctgggaccggcggaccggcgcgccgctcggccgggcg
ctcgtgtggcaggacacccgtacggcgccgctcgtcgacgccctcggagaggaccccggg
gaggcgttcttcctcgaccggtgcggcctgccgccgtcgacctacttctccgcgctgcgc
atccggtggctgttcgaccacgtcaagggggtcgagcagcgcgcccgggacggcgaggtg
ctgttcggcacgatggagagctggctgatctggaacctcaccggcggaaccgacggcggt
ctgcacatcaccgacgtgaccaacgccagccggacgatgctgatgaacatccgcaagctc
gcctgggacgaggagctgctggacttcttccgggtgccgcgctcgatgctgcccgagatc
aggtcgtccgccgagccgtacggcgaggcccgctcgctgctgccgggcgtctccatcacg
gccgcgctcggcgaccagcaggccgccctgttcggccagacctgcttctccccgggcgat
gccaagtgcacctacggaacgggcagcttcctgctgctcaacaccgggtccgacctggtg
cggtcccggcacgggctcctcacgacggtcgcctacaagatcggggaccagcagccggcc
tacgccctggaagggtcgatcgccgtcaccggcgcgctcgtccagtggttccgtgaccgt
ctggggctgatcagcagcgcgccggagatcgagaccctcgcccggacggtcgaggacaac
ggcggctgctacatcgtcccggccttctcgggcctgttcgcgccgcgctggcgcagcgac
gcgcgcggggtcatcgtcgggctcacctcgtacatcaccaagggacacctggcgcgggcc
gtcctggaggccaccgggtggcagacccgggaggtcgtcgacgccatgaacgccgactcc
tcggtcgccctccaccagctcaaggtggacgggggcatgaccgcggacaacctgctcatg
cagttcgtggccgacgtgctcgacgtgccggtggtacggccgatggtcgccgagacggtc
tcgctgggcgccgcttacgcggccgggctcgccgccggctactggtccgacctggaggtg
ctgcgccgcaactggcacaaggccggccagtggctgcccgccatggaccccgagcggcgg
gaggcggagtacgacaactggcagcgggccgtcgagcgctccctgggctgggtccggcca
ccacggccctcctga

DBGET integrated database retrieval system