KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_2100Help
Entry
SHJG_2100         CDS       T02063                                 

Definition
1,4-alpha-glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SHJG_2100
Enzymes [BR:shy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     SHJG_2100
Exosome [BR:shy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SHJG_2100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2558937..2561138
Genome map
AA seq 733 aa AA seqDB search
MALKDTTPPEAAGPRPSAAVALDPADRGRLLAGAHHDPHSVLGAHPVPGGTLLRALRPNA
RAVSVVIDGTPTELRSEGDGLFAAVLPCTEVPSYTLLVAYDDTEQEVHDPYRFLPALGEL
DLHLIREGRHEQLWRALGAEPMVHQGVAGTRFTVWAPNAQGVRVAGDFTYWDGTQYPMRS
LGASGVWELFLPGIGEGTRYKFEITSRYGHRFLKADPMARGTEVPPDTASVVTSSHYEWG
DAEWMAHRGDTPVHQAPFSVYEVHLPSWRPGLTYRQLAEELPPYVKGMGFTHVELMPVAG
YPFSGSWGYQVTSYYAPTPRLGPPDDFRYFVDACHRAGLGVIMDWVPAHFPKDDWALARF
DGDPLYEPGNALRAEHPDWGTYEFDYGRTEVRNFLVANAVYWCEEFHIDGLRVDAVASML
YLDYSRDSGQWEPNVFGGREDLDAVAFLQEMNATVYRRCPGVVTIAEESTAWDGVTRPTD
GGGLGFGLKWNMGWMHDSLEYIQKEPVHRKYHHNEMTFSMVYAYSENYVLPISHDEVVHG
KRALVSKMPGDWWQRRANHRAYLGFMWAHPGKQLLFMGQEFAQGAEWSNTHGPEWWLLSD
DYHSAGDHRGVQALVRDLNTVYRATPALWQRDTDPGGFRWVLCDAADDNVLAFLRFAADG
GPLLAVSNFSPVVRHDYRLWVPDGFPAWREELNTDDTRYGGSGVRTEGPVKPEEGFLRLT
LPPLATVWLTPED
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgaaggacaccacgccccccgaggccgccgggcccaggccctccgcggccgtg
gccctggaccccgccgaccgcggccggctgctggccggcgcgcaccacgatccgcactcc
gtgctgggcgcccacccggtgccgggcggcacgctgctgcgggcgctgcgcccgaacgcg
cgggcggtgagcgtcgtgatcgacggcacgccgaccgaactgcgctcggagggcgacggt
ctgttcgccgccgtcctgccctgtacggaggtcccgtcgtacacgctgctggtggcgtac
gacgacaccgagcaggaggtgcacgacccgtaccgcttcctgcccgccctcggcgaactg
gacctgcacctgatccgggagggccggcacgagcagctgtggcgggcgctcggggccgag
ccgatggtccaccagggcgtggccggcacccgcttcaccgtgtgggcgccgaacgcccag
ggggtgcgggtggccggggacttcacgtactgggacggcacgcagtaccccatgcggtcg
ctcggcgcgtccggggtgtgggagctgttcctgcccgggatcggcgagggcacccggtac
aagttcgagatcacctcgcggtacgggcaccggttcctgaaggcggacccgatggcgcgg
ggcacggaagtcccgccggacacggcgtccgtcgtgacgtcctcgcactacgagtggggt
gacgcggagtggatggcgcaccgcggtgacaccccggtgcaccaggcgccgttctcggtg
tacgaggtgcacctgccgtcctggcgaccggggctgacgtaccgtcagctcgcggaggaa
ctcccgccgtacgtcaaggggatgggcttcacgcacgtggagctgatgccggtggccggg
tacccgttcagcggctcctggggctaccaggtcacctcctactacgcgccgacgccccgg
ctcggccccccggacgacttccggtacttcgtggacgcctgtcaccgggccggtctcggc
gtgatcatggactgggtgccagcgcacttccccaaggacgactgggcgctggcccggttc
gacggggacccgctgtacgagcccgggaacgcgctgcgggcggagcacccggactggggg
acgtacgagttcgactacggccgcaccgaggtgcgcaacttcctcgtcgccaacgcggtg
tactggtgcgaggagttccacatcgacgggctgcgcgtggacgccgtcgcctcgatgctc
tacctggactactcgcgggactccgggcagtgggagcccaatgtgttcggcggccgggag
gacctggacgcggtggccttcctccaggagatgaacgccaccgtgtaccggcgctgcccg
ggcgtggtgaccatcgccgaggagtccaccgcgtgggacggcgtgacccggccgacggac
ggcggcgggctcgggttcgggctgaagtggaacatgggctggatgcacgactcgctggag
tacatccagaaggagccggtgcaccgcaagtaccaccacaacgagatgaccttctcgatg
gtgtacgcctacagcgagaactacgtcctgcccatctcccacgacgaggtggtgcacggc
aagcgggcgctggtgtcgaagatgcccggcgactggtggcagcggcgcgccaaccaccgg
gcctacctcggcttcatgtgggcccacccgggcaaacagctgttgttcatggggcaggag
ttcgcccagggggccgagtggtcgaacacccacggccccgagtggtggctgctctccgac
gactaccactccgccggcgaccaccggggcgtccaggccctggtgcgggacctcaacacg
gtgtaccgggcgacgccggcgctgtggcagcgggacaccgacccgggcggcttccggtgg
gtgctgtgcgacgcggcggacgacaacgtgctggcgttcctgcgcttcgccgccgacggc
ggcccgctgctggcggtgtcgaacttctccccggtcgtccggcacgactaccgcctgtgg
gtccccgacgggttccccgcctggcgcgaggagctgaacaccgacgacacccggtacggc
ggcagcggcgtccgcaccgaggggcccgtcaagcccgaggagggcttcctgaggctgacg
ctgcccccgctcgccaccgtctggctgacgccggaggactga

DBGET integrated database retrieval system