KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_2303Help
Entry
SHJG_2303         CDS       T02063                                 

Definition
(GenBank) glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
shy00220  Arginine biosynthesis
shy00250  Alanine, aspartate and glutamate metabolism
shy00471  D-Glutamine and D-glutamate metabolism
shy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SHJG_2303
   00220 Arginine biosynthesis
    SHJG_2303
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    SHJG_2303
Enzymes [BR:shy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     SHJG_2303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: AEY87578
UniProt: H2JWM5
Position
complement(2777759..2778688)
Genome map
AA seq 309 aa AA seqDB search
MMTIMSSQFQPVLDRIMAEIDRTPGRGRSADYIPALAARDPRRFGMAVAELDGTVYGVGE
WRQPFSTQSITKVFTLALDLAREGDELWEHVGREPSGNPFNSLVQLEYENGIPRNPFINA
GALVVTDRLHTRTGDAAGELLSFLRAESGNPDLGFDEEVAASETAHGDRNAALAHFMASY
GNIDNEVPVLLDQYFRQCSIAASCADLALATGFLARHGIRADGGRLLSRSQAKQVNAVML
TCGTYDAAGDFAYRVGLPGKSGVGGGIIAVVPGRCTLCVWSPGLDERGNSVAGVAALDRF
TTLTGLSVF
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgatgacgatcatgtcctcgcagttccaaccggtcctcgatcgcatcatggcggagatc
gatcgcactcccgggcgcggccggtccgccgactacatcccggcgctcgccgcccgcgac
ccgcgccggttcggcatggccgtcgccgaactggacggcacggtgtacggggtgggggag
tggcggcagccgttctccacgcagtcgatcaccaaggtcttcacgctcgccctggacctg
gcccgcgagggcgacgaactctgggagcacgtgggccgcgagccctccggcaacccgttc
aactccctggtccagctggagtacgagaacggcatcccgcggaaccccttcatcaacgcg
ggcgcgctcgtggtcaccgaccgcctgcacacccgtaccggggacgcggccggcgagctg
ctgtccttcctgcgcgccgagagcggcaaccccgatctcggcttcgacgaggaggtcgcc
gcctccgagaccgcccacggtgaccgcaacgccgccctcgcccacttcatggcgtcctac
ggcaacatcgacaacgaggtgccggtcctgctcgaccagtacttccggcagtgctccatc
gccgcctcctgcgccgacctggccctcgccacgggcttcctcgcccggcacggcatccgc
gccgacggcggccggctgctcagccgcagccaggccaagcaggtcaacgcggtcatgctg
acctgtggcacgtacgacgcggccggcgacttcgcctaccgcgtcggcctgcccggcaag
agcggggtcggcggcgggatcatcgccgtcgtaccgggccggtgcacgctctgcgtgtgg
agcccgggcctggacgaacgcggcaactcggtggcgggtgtggcggccctggaccgtttc
acgaccctgaccgggctgtcggtgttctga

DBGET integrated database retrieval system