KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_2457Help
Entry
SHJG_2457         CDS       T02063                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
shy00010  Glycolysis / Gluconeogenesis
shy00020  Citrate cycle (TCA cycle)
shy00620  Pyruvate metabolism
shy01100  Metabolic pathways
shy01110  Biosynthesis of secondary metabolites
shy01120  Microbial metabolism in diverse environments
shy01130  Biosynthesis of antibiotics
shy01200  Carbon metabolism
Module
shy_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SHJG_2457
   00020 Citrate cycle (TCA cycle)
    SHJG_2457
   00620 Pyruvate metabolism
    SHJG_2457
Enzymes [BR:shy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SHJG_2457
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_6 Abhydrolase_1 Biotin_lipoyl Hydrolase_4 Ser_hydrolase Biotin_lipoyl_2 Thioesterase Ndr DUF676 RnfC_N Abhydrolase_5 PGAP1 Lipase_3 Lipase
Motif
Other DBs
NCBI-ProteinID: AEY87732
UniProt: H2JZT4
Position
complement(2956555..2957676)
Genome map
AA seq 373 aa AA seqDB search
MSTEDAIAKVTMPKWGLSMKSGKITGWLVAEGDEVAEGDELADIDTDKITGVLESSESGV
VRRIIAETNEDVPVGGTIALIAPAHVPEELVDEAARAAREELDSGAVEEVAGPALGTVQV
DGRTLSYATLGTAEETVLLVHGYGGDKNSWLFVQEPLSTRATVHAIDLLGHGDSTKDVGD
GSLDTLAGALLGFLRQQGIERVHLVGHSLGGAVVTAAAAREPGRIASLTLVAPAGYGDAI
NAGYLRGFATASSRRELKPHLVHLFADPGQVTRQLADDLMKFKRLDGVQQALDSLLGTLL
DGDRPGIDAAGLLQKFAGPVRVVWGRADQVLLAANAAALEGRAQVTYVDDAGHMVHMEQP
SAVVDAVTGVLDG
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaccgaagacgccatcgcgaaggtcaccatgcccaagtggggcctgtcgatgaag
agtggcaagatcaccggctggctcgtggccgagggcgacgaggtggccgagggcgacgaa
ctggccgacatcgacaccgacaagatcaccggggtgctcgaatcgtcggagtcgggtgtc
gtgcggcggatcatcgccgagacgaacgaggacgtccccgtcggcggaacgatcgcgctg
atcgctccggcgcacgtgccggaggaactggtcgacgaggcggcccgcgccgcgcgcgag
gaactggactccggcgcggtcgaggaggtcgccggaccagccctcggaacagtgcaggtg
gacggccgtaccctctcctacgcgaccctcggcaccgcggaggagaccgtactgctcgta
cacggttacggcggcgacaagaactcctggctcttcgtccaggaaccactgtcgacccgt
gcgaccgtccacgcgatcgacttgctcggccacggcgactccaccaaggacgtcggcgac
ggttccctcgacaccctggccggcgcgctgctgggcttcctccgacagcagggcatcgaa
cgcgtccacttggtcgggcactcactcggcggcgccgtggtcaccgccgccgccgcccgc
gaacccggtaggatcgcgtcgctgaccctcgtcgcacctgccggctacggcgacgccatc
aacgccggctacctgcgtggattcgccaccgcctcctcacggcgggaactcaagccccac
ctggtccacctgttcgccgatccggggcaggtcacccgccaactcgccgacgacctgatg
aagttcaagcggctcgacggcgtacagcaggcgctcgacagcctgctcggcacgcttctc
gacggcgaccgcccgggcatcgacgccgccggcctgctccagaaattcgcaggcccggta
cgagtggtatggggtcgcgcggaccaggtcctgctggccgccaacgcagctgccctggaa
ggccgcgcccaggtcacctatgtcgacgatgcggggcacatggtccacatggaacagccc
tctgccgtggtcgatgccgtgaccggagtcctggacggctga

DBGET integrated database retrieval system