KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_2526Help
Entry
SHJG_2526         CDS       T02063                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SHJG_2526
  Lipid metabolism
   00561 Glycerolipid metabolism
    SHJG_2526
   00600 Sphingolipid metabolism
    SHJG_2526
Enzymes [BR:shy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SHJG_2526
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3030258..3032243
Genome map
AA seq 661 aa AA seqDB search
MAGALTAGLLCVAGLAAPALAATAETPAAPALADGLALTPPMGFNNWNSTHCRAEFNASM
VEGIADLFVEKGLKDAGYQYVNLDDCWALPDRDANGKLVPDPARFPDGIKAVADYVHAKG
LKLGIYTSAGTKTCDSTGFPGALGHEYSDARQFADWGVDYLKYDNCNNQGVDAQQRYRTM
RDALKATGRPIVYSICEWGQNKPWEWASDVGHLWRTTGDISDSWSSMLSILKQNLPLAPY
AGPGHWNDPDMLEVGNGGMTDTEYRSHFSLWSVMAAPLLIGTDLRKASPATFDILGNKEV
IAVDQDPLGKQGTVVSSGGGRWVVAKEMKDGSRAVALFNESGTAQRIATSASAVGLPDAD
AYTLRDLWQHRTYNTAGTIAATVPAHGTVLLRVAADPRWATHPPAVALGLDGSTLLEAAD
PATLTSTVTDLGRTPARRVSVSLTGPAGWTVRPTSATSAATLAPGGTLRTGWRVTAPSGT
PTGSYGLTLTTNYRSPSGTPVTSTLPLTASVVVPPPAGTSYLGDLPWLSATSGWGPVERN
TSNGESAAGDGSPLTIGGTVYAKGLGVHALSDISFYTGGACEKVTAEVGVDDEKGTKGTV
AFEIWADGTKAASTGVLTNAMPAQSLTADVTGAQVVRLVVTDGGDGVDSDHADWADARLT
C
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
gtggccggagcgctcaccgccggcctgctgtgcgtggcgggcctcgccgcccccgccttg
gcggccaccgccgagacccccgccgcacccgccctcgccgacggcctcgccctcaccccg
ccgatgggcttcaacaactggaactccacccactgccgcgccgagttcaacgcgtccatg
gtcgagggcatcgcggacctgttcgtggagaagggcctgaaggacgcgggctaccagtac
gtcaacctggacgactgctgggccctgccggaccgtgacgcgaacggcaagctggtgccc
gaccccgcccgcttcccggacgggatcaaggcggtcgcggactacgtccacgccaagggg
ctcaagctcggcatctacaccagcgccgggaccaagacctgcgacagcacgggcttcccg
ggcgccctgggccacgagtacagcgacgcgcggcagttcgccgactggggcgtggactac
ctgaagtacgacaactgcaacaaccagggcgtggacgcccagcagcgctaccggaccatg
cgggacgcgctgaaggcgaccgggcggcccatcgtctacagcatctgcgagtggggccag
aacaagccctgggagtgggcctcggacgtcggccacctgtggcggaccaccggtgacatc
agcgacagctggagctcgatgctgtcgatcctgaagcagaacctcccgctcgcgccgtac
gccggccccgggcactggaacgaccccgacatgctggaggtcggcaacggcggcatgacg
gacaccgagtaccgctcgcacttctcgctctggtcggtcatggccgcgcccctgctcatc
ggcaccgacctgcgcaaggcctcccccgcgacctttgacatcctcggcaacaaggaggtc
atcgccgtcgaccaggacccgctcggcaagcagggcaccgtcgtctcctccgggggcggg
cgctgggtcgtcgccaaggagatgaaggacggcagccgcgcggtggccctcttcaacgag
tccggcaccgcccagcggatcgccaccagcgcgagtgccgtcggcctgccggacgccgac
gcctacaccctgcgcgacctgtggcagcaccgcacgtacaacaccgccggcaccatcgcc
gccaccgtcccggcgcacggcacggtcctgctgcgcgtcgcggccgacccgcgctgggcc
acccacccgccggccgtcgcactcggcctggacggcagcacgttgctggaggcggccgac
ccggccacgctcaccagcaccgtcaccgacctcggccggacacccgcgcgacgggtctcc
gtgtcgctgaccggccccgccggctggacggtacggcccacctcggcgacctcggccgcc
acgctcgcccccggcgggacgctgcgcaccggctggcgggtgaccgcgccgtccggcacc
ccgaccggctcctacggcctcacgctcacgacgaactaccgctccccgtccggcacaccg
gtcaccagcacccttccgctgaccgcgtccgtcgtcgtgccgccgcccgccgggacgtcg
tacctcggcgacctgccgtggctgtcggcgaccagcggctggggaccggtggagcggaac
accagcaacggggagagcgccgccggtgacgggagtccgctcaccatcggcgggacggtg
tacgccaaggggctcggcgtccacgcgctcagcgacatctccttctacaccggcggggcc
tgcgagaaggtcaccgcggaggtcggcgtggacgacgagaagggcacgaaggggaccgtc
gccttcgagatctgggcggacggcacgaaggccgcgtccaccggcgtcctcaccaacgcg
atgcccgcccagtcgctcaccgccgacgtgaccggcgcccaggtggtccggctggtcgtc
accgacggcggcgacggcgtcgactcggaccacgcggactgggcggacgcccgcctcacc
tgctga

DBGET integrated database retrieval system